MELO3C030656.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATATATCTTTTGATCTCACCGAGCTAGGAAGAACCCCTGTAGCTGTCATCTCAGCTGGTGTAAAATTGATATTAGACATCTCCAGGACCTTTGAATATTTGGAACAGTCCTCTATTTTCCTGCAATAAACCTTTTTACACATCATGCAGCTTTCTTTTTTATTTATTCACTGGCCCAAAAATGTTATTAACACAGGAAACTCAAGGAGTATGTGTTGCAGCTTATAGAACGACAAACGAATTTTCTGCTTTTTTCATAGAAACCAGTGGCTGCAAG ATGGATATATCTTTTGATCTCACCGAGCTAGGAAGAACCCCTGTAGCTGTCATCTCAGCTGGTGTAAAATTGATATTAGACATCTCCAGGACCTTTGAATATTTGGAAACTCAAGGAGTATGTGTTGCAGCTTATAGAACGACAAACGAATTTTCTGCTTTTTTCATAGAAACCAGTGGCTGCAAG ATGGATATATCTTTTGATCTCACCGAGCTAGGAAGAACCCCTGTAGCTGTCATCTCAGCTGGTGTAAAATTGATATTAGACATCTCCAGGACCTTTGAATATTTGGAAACTCAAGGAGTATGTGTTGCAGCTTATAGAACGACAAACGAATTTTCTGCTTTTTTCATAGAAACCAGTGGCTGCAAG MDISFDLTELGRTPVAVISAGVKLILDISRTFEYLETQGVCVAAYRTTNEFSAFFIETSGCK
BLAST of MELO3C030656.2 vs. NCBI nr
Match: XP_004139051.1 (PREDICTED: pseudouridine-metabolizing bifunctional protein C1861.05 [Cucumis sativus] >XP_011660154.1 PREDICTED: pseudouridine-metabolizing bifunctional protein C1861.05 [Cucumis sativus] >KGN66518.1 hypothetical protein Csa_1G616850 [Cucumis sativus]) HSP 1 Score: 105.1 bits (261), Expect = 8.5e-20 Identity = 55/62 (88.71%), Postives = 55/62 (88.71%), Query Frame = 0
BLAST of MELO3C030656.2 vs. NCBI nr
Match: XP_009356077.1 (PREDICTED: uncharacterized protein LOC103946974 [Pyrus x bretschneideri] >XP_009356079.1 PREDICTED: uncharacterized protein LOC103946974 [Pyrus x bretschneideri] >XP_009356080.1 PREDICTED: uncharacterized protein LOC103946974 [Pyrus x bretschneideri]) HSP 1 Score: 105.1 bits (261), Expect = 8.5e-20 Identity = 55/62 (88.71%), Postives = 55/62 (88.71%), Query Frame = 0
BLAST of MELO3C030656.2 vs. NCBI nr
Match: XP_009338535.1 (PREDICTED: uncharacterized protein LOC103930867 [Pyrus x bretschneideri] >XP_009338536.1 PREDICTED: uncharacterized protein LOC103930867 [Pyrus x bretschneideri] >XP_009338538.1 PREDICTED: uncharacterized protein LOC103930867 [Pyrus x bretschneideri]) HSP 1 Score: 105.1 bits (261), Expect = 8.5e-20 Identity = 55/62 (88.71%), Postives = 55/62 (88.71%), Query Frame = 0
BLAST of MELO3C030656.2 vs. NCBI nr
Match: XP_022960638.1 (uncharacterized protein LOC111461367 [Cucurbita moschata]) HSP 1 Score: 105.1 bits (261), Expect = 8.5e-20 Identity = 55/62 (88.71%), Postives = 55/62 (88.71%), Query Frame = 0
BLAST of MELO3C030656.2 vs. NCBI nr
Match: XP_008450374.1 (PREDICTED: pseudouridine-5'-phosphate glycosidase isoform X1 [Cucumis melo]) HSP 1 Score: 104.8 bits (260), Expect = 1.1e-19 Identity = 54/62 (87.10%), Postives = 55/62 (88.71%), Query Frame = 0
BLAST of MELO3C030656.2 vs. TAIR10
Match: AT1G50510.1 (indigoidine synthase A family protein) HSP 1 Score: 87.0 bits (214), Expect = 4.3e-18 Identity = 46/62 (74.19%), Postives = 51/62 (82.26%), Query Frame = 0
BLAST of MELO3C030656.2 vs. Swiss-Prot
Match: sp|C0ZIY1|PSUG_BREBN (Pseudouridine-5'-phosphate glycosidase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) OX=358681 GN=psuG PE=3 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 2.6e-12 Identity = 38/59 (64.41%), Postives = 43/59 (72.88%), Query Frame = 0
BLAST of MELO3C030656.2 vs. Swiss-Prot
Match: sp|Q1M4T3|PSUG2_RHIL3 (Pseudouridine-5'-phosphate glycosidase 2 OS=Rhizobium leguminosarum bv. viciae (strain 3841) OX=216596 GN=psuG2 PE=3 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 3.4e-12 Identity = 40/61 (65.57%), Postives = 44/61 (72.13%), Query Frame = 0
BLAST of MELO3C030656.2 vs. Swiss-Prot
Match: sp|B9LGZ1|PSUG_CHLSY (Pseudouridine-5'-phosphate glycosidase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) OX=480224 GN=psuG PE=3 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 4.4e-12 Identity = 37/59 (62.71%), Postives = 42/59 (71.19%), Query Frame = 0
BLAST of MELO3C030656.2 vs. Swiss-Prot
Match: sp|B8II14|PSUG_METNO (Pseudouridine-5'-phosphate glycosidase OS=Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060) OX=460265 GN=psuG PE=3 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 7.6e-12 Identity = 37/60 (61.67%), Postives = 43/60 (71.67%), Query Frame = 0
BLAST of MELO3C030656.2 vs. Swiss-Prot
Match: sp|Q8NYD0|PSUG_STAAW (Pseudouridine-5'-phosphate glycosidase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=psuG PE=3 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 6.4e-11 Identity = 37/62 (59.68%), Postives = 42/62 (67.74%), Query Frame = 0
BLAST of MELO3C030656.2 vs. TrEMBL
Match: tr|A0A0A0LXQ4|A0A0A0LXQ4_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G616850 PE=3 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 5.6e-20 Identity = 55/62 (88.71%), Postives = 55/62 (88.71%), Query Frame = 0
BLAST of MELO3C030656.2 vs. TrEMBL
Match: tr|A0A1S3BQ44|A0A1S3BQ44_CUCME (pseudouridine-5'-phosphate glycosidase isoform X1 OS=Cucumis melo OX=3656 GN=LOC103492003 PE=3 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 7.3e-20 Identity = 54/62 (87.10%), Postives = 55/62 (88.71%), Query Frame = 0
BLAST of MELO3C030656.2 vs. TrEMBL
Match: tr|A0A1S3BNH4|A0A1S3BNH4_CUCME (pseudouridine-5'-phosphate glycosidase isoform X2 OS=Cucumis melo OX=3656 GN=LOC103492003 PE=3 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 7.3e-20 Identity = 54/62 (87.10%), Postives = 55/62 (88.71%), Query Frame = 0
BLAST of MELO3C030656.2 vs. TrEMBL
Match: tr|A0A1S3BP55|A0A1S3BP55_CUCME (pseudouridine-5'-phosphate glycosidase isoform X3 OS=Cucumis melo OX=3656 GN=LOC103492003 PE=3 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 7.3e-20 Identity = 54/62 (87.10%), Postives = 55/62 (88.71%), Query Frame = 0
BLAST of MELO3C030656.2 vs. TrEMBL
Match: tr|M5X1Q1|M5X1Q1_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_ppa009681mg PE=3 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 9.5e-20 Identity = 54/62 (87.10%), Postives = 55/62 (88.71%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |