MELO3C030585.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: five_prime_UTRexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.GATTGTAAGAAATATCTATTGGGAAGTTTGTAGATGAGACGAAAGCTCAAATGCTGAAAGATAAATGCTTACCATTAGAAGAATGTGTTGTGGTTGTTGGGCGCACTGACAAAGGGGTGACAGCTCTACAACAAGTTTGCACATTTTGTATGTTAGCTTCCTAA GATTGTAAGAAATATCTATTGGGAAGTTTGTAGATGAGACGAAAGCTCAAATGCTGAAAGATAAATGCTTACCATTAGAAGAATGTGTTGTGGTTGTTGGGCGCACTGACAAAGGGGTGACAGCTCTACAACAAGTTTGCACATTTTGTATGTTAGCTTCCTAA ATGCTGAAAGATAAATGCTTACCATTAGAAGAATGTGTTGTGGTTGTTGGGCGCACTGACAAAGGGGTGACAGCTCTACAACAAGTTTGCACATTTTGTATGTTAGCTTCCTAA MLKDKCLPLEECVVVVGRTDKGVTALQQVCTFCMLAS
BLAST of MELO3C030585.2 vs. NCBI nr
Match: XP_024028370.1 (uncharacterized protein LOC21391583 isoform X2 [Morus notabilis]) HSP 1 Score: 61.2 bits (147), Expect = 8.4e-07 Identity = 27/32 (84.38%), Postives = 29/32 (90.62%), Query Frame = 0
BLAST of MELO3C030585.2 vs. NCBI nr
Match: XP_010106935.1 (uncharacterized protein LOC21391583 isoform X1 [Morus notabilis] >EXC12817.1 tRNA pseudouridine synthase A [Morus notabilis]) HSP 1 Score: 61.2 bits (147), Expect = 8.4e-07 Identity = 27/32 (84.38%), Postives = 29/32 (90.62%), Query Frame = 0
BLAST of MELO3C030585.2 vs. NCBI nr
Match: XP_008453520.1 (PREDICTED: tRNA pseudouridine synthase A [Cucumis melo]) HSP 1 Score: 60.5 bits (145), Expect = 1.4e-06 Identity = 27/32 (84.38%), Postives = 29/32 (90.62%), Query Frame = 0
BLAST of MELO3C030585.2 vs. NCBI nr
Match: XP_015881667.1 (uncharacterized protein LOC107417573 [Ziziphus jujuba]) HSP 1 Score: 60.5 bits (145), Expect = 1.4e-06 Identity = 27/32 (84.38%), Postives = 29/32 (90.62%), Query Frame = 0
BLAST of MELO3C030585.2 vs. NCBI nr
Match: XP_015881730.1 (uncharacterized protein LOC107417627 [Ziziphus jujuba]) HSP 1 Score: 60.5 bits (145), Expect = 1.4e-06 Identity = 27/32 (84.38%), Postives = 29/32 (90.62%), Query Frame = 0
BLAST of MELO3C030585.2 vs. TAIR10
Match: AT5G35400.2 (Pseudouridine synthase family protein) HSP 1 Score: 48.1 bits (113), Expect = 1.3e-06 Identity = 22/32 (68.75%), Postives = 26/32 (81.25%), Query Frame = 0
BLAST of MELO3C030585.2 vs. TrEMBL
Match: tr|W9S3H9|W9S3H9_9ROSA (tRNA pseudouridine synthase OS=Morus notabilis OX=981085 GN=L484_008208 PE=3 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 5.5e-07 Identity = 27/32 (84.38%), Postives = 29/32 (90.62%), Query Frame = 0
BLAST of MELO3C030585.2 vs. TrEMBL
Match: tr|A0A1S3BWI6|A0A1S3BWI6_CUCME (tRNA pseudouridine synthase OS=Cucumis melo OX=3656 GN=LOC103494203 PE=3 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 9.4e-07 Identity = 27/32 (84.38%), Postives = 29/32 (90.62%), Query Frame = 0
BLAST of MELO3C030585.2 vs. TrEMBL
Match: tr|A0A0A0LV59|A0A0A0LV59_CUCSA (tRNA pseudouridine synthase OS=Cucumis sativus OX=3659 GN=Csa_1G025830 PE=3 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 2.1e-06 Identity = 26/32 (81.25%), Postives = 29/32 (90.62%), Query Frame = 0
BLAST of MELO3C030585.2 vs. TrEMBL
Match: tr|A0A2P2K145|A0A2P2K145_RHIMU (tRNA pseudouridine synthase OS=Rhizophora mucronata OX=61149 PE=4 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 1.8e-05 Identity = 26/35 (74.29%), Postives = 29/35 (82.86%), Query Frame = 0
BLAST of MELO3C030585.2 vs. TrEMBL
Match: tr|V4UJT6|V4UJT6_9ROSI (tRNA pseudouridine synthase OS=Citrus clementina OX=85681 GN=CICLE_v10008288mg PE=3 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 2.3e-05 Identity = 24/32 (75.00%), Postives = 28/32 (87.50%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|