MELO3C029498.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.TGGGCAGAAGCAATCGAAAGTTTGGATGATGGAGTCCTAGGATCGGATAAGAGCTTTGGCATGAAGCAAAGGCCAGATGGTGATATTGAAATCGATGAAAAATATTGGGAGCATGATTTCTGTATTCCAGCCTGCCAAAAATGCAACGGAGTGTTCAAACCTGAT TGGGCAGAAGCAATCGAAAGTTTGGATGATGGAGTCCTAGGATCGGATAAGAGCTTTGGCATGAAGCAAAGGCCAGATGGTGATATTGAAATCGATGAAAAATATTGGGAGCATGATTTCTGTATTCCAGCCTGCCAAAAATGCAACGGAGTGTTCAAACCTGAT ATGAAGCAAAGGCCAGATGGTGATATTGAAATCGATGAAAAATATTGGGAGCATGATTTCTGTATTCCAGCCTGCCAAAAATGCAACGGAGTGTTCAAACCTGAT MKQRPDGDIEIDEKYWEHDFCIPACQKCNGVFKPD
BLAST of MELO3C029498.2 vs. NCBI nr
Match: XP_008460860.1 (PREDICTED: NAD-dependent protein deacylase SRT2 isoform X1 [Cucumis melo] >XP_008460861.1 PREDICTED: NAD-dependent protein deacylase SRT2 isoform X1 [Cucumis melo] >XP_008460862.1 PREDICTED: NAD-dependent protein deacylase SRT2 isoform X1 [Cucumis melo]) HSP 1 Score: 83.6 bits (205), Expect = 1.5e-13 Identity = 33/35 (94.29%), Postives = 33/35 (94.29%), Query Frame = 0
BLAST of MELO3C029498.2 vs. NCBI nr
Match: XP_016902604.1 (PREDICTED: NAD-dependent protein deacylase SRT2 isoform X2 [Cucumis melo]) HSP 1 Score: 83.6 bits (205), Expect = 1.5e-13 Identity = 33/35 (94.29%), Postives = 33/35 (94.29%), Query Frame = 0
BLAST of MELO3C029498.2 vs. NCBI nr
Match: KGN62218.1 (hypothetical protein Csa_2G336650 [Cucumis sativus]) HSP 1 Score: 82.0 bits (201), Expect = 4.3e-13 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 0
BLAST of MELO3C029498.2 vs. NCBI nr
Match: XP_011649435.1 (PREDICTED: LOW QUALITY PROTEIN: NAD-dependent protein deacetylase SRT2 [Cucumis sativus]) HSP 1 Score: 82.0 bits (201), Expect = 4.3e-13 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 0
BLAST of MELO3C029498.2 vs. NCBI nr
Match: XP_010269049.1 (PREDICTED: NAD-dependent protein deacylase SRT2 isoform X1 [Nelumbo nucifera]) HSP 1 Score: 79.0 bits (193), Expect = 3.7e-12 Identity = 31/35 (88.57%), Postives = 32/35 (91.43%), Query Frame = 0
BLAST of MELO3C029498.2 vs. TAIR10
Match: AT5G09230.7 (sirtuin 2) HSP 1 Score: 68.2 bits (165), Expect = 1.2e-12 Identity = 27/35 (77.14%), Postives = 29/35 (82.86%), Query Frame = 0
BLAST of MELO3C029498.2 vs. Swiss-Prot
Match: sp|Q94AQ6|SIR4_ARATH (NAD-dependent protein deacylase SRT2 OS=Arabidopsis thaliana OX=3702 GN=SRT2 PE=2 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 2.1e-11 Identity = 27/35 (77.14%), Postives = 29/35 (82.86%), Query Frame = 0
BLAST of MELO3C029498.2 vs. TrEMBL
Match: tr|A0A1S3CDW2|A0A1S3CDW2_CUCME (NAD-dependent protein deacylase OS=Cucumis melo OX=3656 GN=LOC103499610 PE=3 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 9.8e-14 Identity = 33/35 (94.29%), Postives = 33/35 (94.29%), Query Frame = 0
BLAST of MELO3C029498.2 vs. TrEMBL
Match: tr|A0A1S4E2Z3|A0A1S4E2Z3_CUCME (NAD-dependent protein deacylase OS=Cucumis melo OX=3656 GN=LOC103499610 PE=3 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 9.8e-14 Identity = 33/35 (94.29%), Postives = 33/35 (94.29%), Query Frame = 0
BLAST of MELO3C029498.2 vs. TrEMBL
Match: tr|A0A0A0LK90|A0A0A0LK90_CUCSA (NAD-dependent protein deacylase OS=Cucumis sativus OX=3659 GN=Csa_2G336650 PE=3 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 2.9e-13 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 0
BLAST of MELO3C029498.2 vs. TrEMBL
Match: tr|A0A1U8ARR6|A0A1U8ARR6_NELNU (NAD-dependent protein deacylase SRT2 isoform X2 OS=Nelumbo nucifera OX=4432 GN=LOC104605829 PE=4 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 2.4e-12 Identity = 31/35 (88.57%), Postives = 32/35 (91.43%), Query Frame = 0
BLAST of MELO3C029498.2 vs. TrEMBL
Match: tr|A0A1U8B0J4|A0A1U8B0J4_NELNU (NAD-dependent protein deacylase OS=Nelumbo nucifera OX=4432 GN=LOC104605829 PE=3 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 2.4e-12 Identity = 31/35 (88.57%), Postives = 32/35 (91.43%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|