MELO3C029435.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: five_prime_UTRexonCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.TAGGTATATTGAAGGAGATTTTGATGCGTATGTGAAGCAAATTCAGCAACCTTTCGTGTGGGGTGGAGAACCTGAGTTACTTATGGCATCTCATATTCTGAAGTAAGTTTTCATTTATATTGCTAACCACAATTTTGTCTCATGAGTTTATATAAAAATTTATCCAAAAAAAAAAAGAGAAAGTAATAAACAAAATGCT TAGGTATATTGAAGGAGATTTTGATGCGTATGTGAAGCAAATTCAGCAACCTTTCGTGTGGGGTGGAGAACCTGAGTTACTTATGGCATCTCATATTCTGAAGTAAGTTTTCATTTATATTGCTAACCACAATTTTGTCTCATGAGTTTATATAAAAATTTATCCAAAAAAAAAAAGAGAAAGTAATAAACAAAATGCT AGGTATATTGAAGGAGATTTTGATGCGTATGTGAAGCAAATTCAGCAACCTTTCGTGTGGGGTGGAGAACCTGAGTTACTTATGGCATCTCATATTCTGAAGTAA RYIEGDFDAYVKQIQQPFVWGGEPELLMASHILK
BLAST of MELO3C029435.2 vs. NCBI nr
Match: XP_004142455.1 (PREDICTED: OTU domain-containing protein At3g57810-like [Cucumis sativus] >KGN52210.1 hypothetical protein Csa_5G615810 [Cucumis sativus]) HSP 1 Score: 73.2 bits (178), Expect = 2.0e-10 Identity = 31/33 (93.94%), Postives = 33/33 (100.00%), Query Frame = 0
BLAST of MELO3C029435.2 vs. NCBI nr
Match: XP_016900257.1 (PREDICTED: OTU domain-containing protein At3g57810-like [Cucumis melo]) HSP 1 Score: 73.2 bits (178), Expect = 2.0e-10 Identity = 31/33 (93.94%), Postives = 33/33 (100.00%), Query Frame = 0
BLAST of MELO3C029435.2 vs. NCBI nr
Match: XP_022139298.1 (OTU domain-containing protein At3g57810-like [Momordica charantia]) HSP 1 Score: 73.2 bits (178), Expect = 2.0e-10 Identity = 31/33 (93.94%), Postives = 33/33 (100.00%), Query Frame = 0
BLAST of MELO3C029435.2 vs. NCBI nr
Match: XP_017647111.1 (PREDICTED: uncharacterized protein LOC108487313 [Gossypium arboreum] >KHG26701.1 hypothetical protein F383_04817 [Gossypium arboreum]) HSP 1 Score: 72.4 bits (176), Expect = 3.3e-10 Identity = 30/33 (90.91%), Postives = 33/33 (100.00%), Query Frame = 0
BLAST of MELO3C029435.2 vs. NCBI nr
Match: XP_016676961.1 (PREDICTED: OTU domain-containing protein At3g57810-like [Gossypium hirsutum]) HSP 1 Score: 72.4 bits (176), Expect = 3.3e-10 Identity = 30/33 (90.91%), Postives = 33/33 (100.00%), Query Frame = 0
BLAST of MELO3C029435.2 vs. TAIR10
Match: AT3G57810.2 (Cysteine proteinases superfamily protein) HSP 1 Score: 60.8 bits (146), Expect = 1.8e-10 Identity = 23/33 (69.70%), Postives = 29/33 (87.88%), Query Frame = 0
BLAST of MELO3C029435.2 vs. Swiss-Prot
Match: sp|Q8LBZ4|OTU_ARATH (OTU domain-containing protein At3g57810 OS=Arabidopsis thaliana OX=3702 GN=At3g57810 PE=2 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 3.3e-09 Identity = 23/33 (69.70%), Postives = 29/33 (87.88%), Query Frame = 0
BLAST of MELO3C029435.2 vs. TrEMBL
Match: tr|A0A1S4DW93|A0A1S4DW93_CUCME (OTU domain-containing protein At3g57810-like OS=Cucumis melo OX=3656 GN=LOC103489409 PE=4 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.3e-10 Identity = 31/33 (93.94%), Postives = 33/33 (100.00%), Query Frame = 0
BLAST of MELO3C029435.2 vs. TrEMBL
Match: tr|A0A0A0KRE9|A0A0A0KRE9_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G615810 PE=4 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.3e-10 Identity = 31/33 (93.94%), Postives = 33/33 (100.00%), Query Frame = 0
BLAST of MELO3C029435.2 vs. TrEMBL
Match: tr|A0A0B0PTG1|A0A0B0PTG1_GOSAR (Uncharacterized protein OS=Gossypium arboreum OX=29729 GN=F383_04817 PE=4 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 2.2e-10 Identity = 30/33 (90.91%), Postives = 33/33 (100.00%), Query Frame = 0
BLAST of MELO3C029435.2 vs. TrEMBL
Match: tr|A0A1U8IFM4|A0A1U8IFM4_GOSHI (OTU domain-containing protein At3g57810-like OS=Gossypium hirsutum OX=3635 GN=LOC107896321 PE=4 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 2.2e-10 Identity = 30/33 (90.91%), Postives = 33/33 (100.00%), Query Frame = 0
BLAST of MELO3C029435.2 vs. TrEMBL
Match: tr|A0A2P5YME4|A0A2P5YME4_GOSBA (Uncharacterized protein OS=Gossypium barbadense OX=3634 GN=GOBAR_AA03872 PE=4 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 2.2e-10 Identity = 30/33 (90.91%), Postives = 33/33 (100.00%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|