MELO3C029418.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: five_prime_UTRexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.TTTTTGATAGGAATGTTGGATATGTTCAGGTATGAATCTTCTTTTTGCATCAATCATATGTATATTAACAATTGTATTTGGTAGTGAATGGTATGTAATACTTTTAAGTGTGTAGGGGATGAGATTTTTAACTGATTTGTTGCTTCTCTATATGAGTGAAGAGGATGCATTCTGGTTGTTGGCCGAATTACTCAAAGGTGAAGTTCATGCTCCAATGGAAGGATTATATATGGTAACTCTATTCTTTTAG TTTTTGATAGGAATGTTGGATATGTTCAGGGGATGAGATTTTTAACTGATTTGTTGCTTCTCTATATGAGTGAAGAGGATGCATTCTGGTTGTTGGCCGAATTACTCAAAGGTGAAGTTCATGCTCCAATGGAAGGATTATATATGGTAACTCTATTCTTTTAG ATGAGATTTTTAACTGATTTGTTGCTTCTCTATATGAGTGAAGAGGATGCATTCTGGTTGTTGGCCGAATTACTCAAAGGTGAAGTTCATGCTCCAATGGAAGGATTATATATGGTAACTCTATTCTTTTAG MRFLTDLLLLYMSEEDAFWLLAELLKGEVHAPMEGLYMVTLFF
BLAST of MELO3C029418.2 vs. NCBI nr
Match: PNR37908.1 (hypothetical protein PHYPA_021018 [Physcomitrella patens]) HSP 1 Score: 65.5 bits (158), Expect = 5.2e-08 Identity = 33/41 (80.49%), Postives = 34/41 (82.93%), Query Frame = 0
BLAST of MELO3C029418.2 vs. NCBI nr
Match: ERN05822.1 (hypothetical protein AMTR_s00006p00260160 [Amborella trichopoda]) HSP 1 Score: 65.5 bits (158), Expect = 5.2e-08 Identity = 33/41 (80.49%), Postives = 34/41 (82.93%), Query Frame = 0
BLAST of MELO3C029418.2 vs. NCBI nr
Match: XP_010261829.1 (PREDICTED: EVI5-like protein [Nelumbo nucifera]) HSP 1 Score: 65.5 bits (158), Expect = 5.2e-08 Identity = 33/41 (80.49%), Postives = 34/41 (82.93%), Query Frame = 0
BLAST of MELO3C029418.2 vs. NCBI nr
Match: XP_011092196.1 (ecotropic viral integration site 5 protein homolog isoform X1 [Sesamum indicum] >XP_011092197.1 ecotropic viral integration site 5 protein homolog isoform X1 [Sesamum indicum] >XP_020553026.1 ecotropic viral integration site 5 protein homolog isoform X1 [Sesamum indicum] >XP_020553027.1 ecotropic viral integration site 5 protein homolog isoform X1 [Sesamum indicum]) HSP 1 Score: 65.5 bits (158), Expect = 5.2e-08 Identity = 33/41 (80.49%), Postives = 34/41 (82.93%), Query Frame = 0
BLAST of MELO3C029418.2 vs. NCBI nr
Match: XP_006844147.2 (EVI5-like protein isoform X1 [Amborella trichopoda] >XP_020522727.1 EVI5-like protein isoform X1 [Amborella trichopoda] >XP_020522728.1 EVI5-like protein isoform X1 [Amborella trichopoda] >XP_020522729.1 EVI5-like protein isoform X1 [Amborella trichopoda]) HSP 1 Score: 65.5 bits (158), Expect = 5.2e-08 Identity = 33/41 (80.49%), Postives = 34/41 (82.93%), Query Frame = 0
BLAST of MELO3C029418.2 vs. TAIR10
Match: AT3G02460.1 (Ypt/Rab-GAP domain of gyp1p superfamily protein) HSP 1 Score: 62.0 bits (149), Expect = 1.0e-10 Identity = 30/37 (81.08%), Postives = 31/37 (83.78%), Query Frame = 0
BLAST of MELO3C029418.2 vs. TAIR10
Match: AT5G15930.1 (plant adhesion molecule 1) HSP 1 Score: 59.7 bits (143), Expect = 5.1e-10 Identity = 29/41 (70.73%), Postives = 32/41 (78.05%), Query Frame = 0
BLAST of MELO3C029418.2 vs. TrEMBL
Match: tr|M0U1F1|M0U1F1_MUSAM (Uncharacterized protein OS=Musa acuminata subsp. malaccensis OX=214687 PE=4 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 9.0e-09 Identity = 33/42 (78.57%), Postives = 34/42 (80.95%), Query Frame = 0
BLAST of MELO3C029418.2 vs. TrEMBL
Match: tr|A9RKU9|A9RKU9_PHYPA (Predicted protein OS=Physcomitrella patens subsp. patens OX=3218 GN=PHYPA_021018 PE=4 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 3.4e-08 Identity = 33/41 (80.49%), Postives = 34/41 (82.93%), Query Frame = 0
BLAST of MELO3C029418.2 vs. TrEMBL
Match: tr|A0A1S4E059|A0A1S4E059_CUCME (DNA repair protein recA homolog 1, chloroplastic-like isoform X1 OS=Cucumis melo OX=3656 GN=LOC103495083 PE=4 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 3.4e-08 Identity = 32/38 (84.21%), Postives = 33/38 (86.84%), Query Frame = 0
BLAST of MELO3C029418.2 vs. TrEMBL
Match: tr|W9RDZ6|W9RDZ6_9ROSA (TBC1 domain family member OS=Morus notabilis OX=981085 GN=L484_009677 PE=4 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 3.4e-08 Identity = 33/41 (80.49%), Postives = 34/41 (82.93%), Query Frame = 0
BLAST of MELO3C029418.2 vs. TrEMBL
Match: tr|A0A2N9FTM2|A0A2N9FTM2_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS18425 PE=4 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 3.4e-08 Identity = 33/41 (80.49%), Postives = 34/41 (82.93%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|