MELO3C028950.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAATAATAATAGTGATGATGATGATGAAGGTGGGACATTTGCATTATATTCATTACTATGTCGTTACGCGAAAATCGGGCTAATACCAAGCCAACAAGCAGAGAAGATCAAGAGGTATCAAATTTTCAACTACATCTTCCCTCCAATCGTCTTAAAATGGCCTCTTCTCTTAAATCTAAACTCGAAAACAACCGCCCCGGCTAAGATGTTCTTGCTCTTCGCCACCATGCTCGGCACTTCCATGGTTATCGGTGATGGCGTGCTCAGTCCTTCATCTCCGGTGACCAACTTTTCTTCTTTTTCCTTTTTTATATATATTTTGCATGGGAAAAAAACTTGGATGTAATTTAGGTGTTACACAATTACACACACCTAATTAAAGGATGTTTAAATCTTAACCTTTTGGTGGCAGTTTTGTCGACTGTTGGAGGAATCAAGAATGCTACCCCGAGTATGA ATGAATAATAATAGTGATGATGATGATGAAGGTGGGACATTTGCATTATATTCATTACTATGTCGTTACGCGAAAATCGGGCTAATACCAAGCCAACAAGCAGAGAAGATCAAGAGGTATCAAATTTTCAACTACATCTTCCCTCCAATCGTCTTAAAATGGCCTCTTCTCTTAAATCTAAACTCGAAAACAACCGCCCCGGCTAAGATGTTCTTGCTCTTCGCCACCATGCTCGGCACTTCCATGGTTATCGGTGATGGCGTGCTCAGTCCTTCATCTCCGTTTTGTCGACTGTTGGAGGAATCAAGAATGCTACCCCGAGTATGA ATGAATAATAATAGTGATGATGATGATGAAGGTGGGACATTTGCATTATATTCATTACTATGTCGTTACGCGAAAATCGGGCTAATACCAAGCCAACAAGCAGAGAAGATCAAGAGGTATCAAATTTTCAACTACATCTTCCCTCCAATCGTCTTAAAATGGCCTCTTCTCTTAAATCTAAACTCGAAAACAACCGCCCCGGCTAAGATGTTCTTGCTCTTCGCCACCATGCTCGGCACTTCCATGGTTATCGGTGATGGCGTGCTCAGTCCTTCATCTCCGTTTTGTCGACTGTTGGAGGAATCAAGAATGCTACCCCGAGTATGA MNNNSDDDDEGGTFALYSLLCRYAKIGLIPSQQAEKIKRYQIFNYIFPPIVLKWPLLLNLNSKTTAPAKMFLLFATMLGTSMVIGDGVLSPSSPFCRLLEESRMLPRV
BLAST of MELO3C028950.2 vs. NCBI nr
Match: XP_004136176.1 (PREDICTED: potassium transporter 5-like [Cucumis sativus] >KGN44911.1 hypothetical protein Csa_7G395780 [Cucumis sativus]) HSP 1 Score: 87.0 bits (214), Expect = 4.2e-14 Identity = 50/80 (62.50%), Postives = 56/80 (70.00%), Query Frame = 0
BLAST of MELO3C028950.2 vs. NCBI nr
Match: XP_022144450.1 (potassium transporter 5-like [Momordica charantia]) HSP 1 Score: 86.7 bits (213), Expect = 5.4e-14 Identity = 49/80 (61.25%), Postives = 55/80 (68.75%), Query Frame = 0
BLAST of MELO3C028950.2 vs. NCBI nr
Match: XP_008451612.1 (PREDICTED: potassium transporter 5-like [Cucumis melo]) HSP 1 Score: 85.1 bits (209), Expect = 1.6e-13 Identity = 49/80 (61.25%), Postives = 55/80 (68.75%), Query Frame = 0
BLAST of MELO3C028950.2 vs. NCBI nr
Match: XP_022959570.1 (potassium transporter 5-like [Cucurbita moschata]) HSP 1 Score: 85.1 bits (209), Expect = 1.6e-13 Identity = 50/82 (60.98%), Postives = 58/82 (70.73%), Query Frame = 0
BLAST of MELO3C028950.2 vs. NCBI nr
Match: XP_023004468.1 (potassium transporter 5-like [Cucurbita maxima]) HSP 1 Score: 85.1 bits (209), Expect = 1.6e-13 Identity = 50/82 (60.98%), Postives = 58/82 (70.73%), Query Frame = 0
BLAST of MELO3C028950.2 vs. TAIR10
Match: AT4G13420.1 (high affinity K+ transporter 5) HSP 1 Score: 70.5 bits (171), Expect = 7.3e-13 Identity = 38/82 (46.34%), Postives = 55/82 (67.07%), Query Frame = 0
BLAST of MELO3C028950.2 vs. TAIR10
Match: AT1G60160.1 (Potassium transporter family protein) HSP 1 Score: 60.1 bits (144), Expect = 9.9e-10 Identity = 33/80 (41.25%), Postives = 48/80 (60.00%), Query Frame = 0
BLAST of MELO3C028950.2 vs. TAIR10
Match: AT3G02050.1 (K+ uptake transporter 3) HSP 1 Score: 55.8 bits (133), Expect = 1.9e-08 Identity = 35/90 (38.89%), Postives = 51/90 (56.67%), Query Frame = 0
BLAST of MELO3C028950.2 vs. TAIR10
Match: AT1G31120.1 (K+ uptake permease 10) HSP 1 Score: 52.0 bits (123), Expect = 2.7e-07 Identity = 35/85 (41.18%), Postives = 48/85 (56.47%), Query Frame = 0
BLAST of MELO3C028950.2 vs. TAIR10
Match: AT2G30070.1 (potassium transporter 1) HSP 1 Score: 52.0 bits (123), Expect = 2.7e-07 Identity = 34/82 (41.46%), Postives = 46/82 (56.10%), Query Frame = 0
BLAST of MELO3C028950.2 vs. Swiss-Prot
Match: sp|Q9M7K4|POT5_ARATH (Potassium transporter 5 OS=Arabidopsis thaliana OX=3702 GN=POT5 PE=1 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 1.3e-11 Identity = 38/82 (46.34%), Postives = 55/82 (67.07%), Query Frame = 0
BLAST of MELO3C028950.2 vs. Swiss-Prot
Match: sp|Q6VVA6|HAK1_ORYSJ (Potassium transporter 1 OS=Oryza sativa subsp. japonica OX=39947 GN=HAK1 PE=1 SV=2) HSP 1 Score: 64.3 bits (155), Expect = 9.4e-10 Identity = 39/82 (47.56%), Postives = 52/82 (63.41%), Query Frame = 0
BLAST of MELO3C028950.2 vs. Swiss-Prot
Match: sp|Q6H4R6|HAK23_ORYSJ (Potassium transporter 23 OS=Oryza sativa subsp. japonica OX=39947 GN=HAK23 PE=2 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 1.6e-09 Identity = 36/80 (45.00%), Postives = 49/80 (61.25%), Query Frame = 0
BLAST of MELO3C028950.2 vs. Swiss-Prot
Match: sp|O80739|POT12_ARATH (Putative potassium transporter 12 OS=Arabidopsis thaliana OX=3702 GN=POT12 PE=1 SV=2) HSP 1 Score: 60.1 bits (144), Expect = 1.8e-08 Identity = 33/80 (41.25%), Postives = 48/80 (60.00%), Query Frame = 0
BLAST of MELO3C028950.2 vs. Swiss-Prot
Match: sp|Q5JK32|HAK5_ORYSJ (Potassium transporter 5 OS=Oryza sativa subsp. japonica OX=39947 GN=HAK5 PE=2 SV=2) HSP 1 Score: 58.5 bits (140), Expect = 5.2e-08 Identity = 36/81 (44.44%), Postives = 50/81 (61.73%), Query Frame = 0
BLAST of MELO3C028950.2 vs. TrEMBL
Match: tr|A0A0A0KAT8|A0A0A0KAT8_CUCSA (Potassium transporter OS=Cucumis sativus OX=3659 GN=Csa_7G395780 PE=3 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 2.7e-14 Identity = 50/80 (62.50%), Postives = 56/80 (70.00%), Query Frame = 0
BLAST of MELO3C028950.2 vs. TrEMBL
Match: tr|A0A1S3BRV9|A0A1S3BRV9_CUCME (Potassium transporter OS=Cucumis melo OX=3656 GN=LOC103492847 PE=3 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 1.0e-13 Identity = 49/80 (61.25%), Postives = 55/80 (68.75%), Query Frame = 0
BLAST of MELO3C028950.2 vs. TrEMBL
Match: tr|A0A0A0K5Z5|A0A0A0K5Z5_CUCSA (Potassium transporter OS=Cucumis sativus OX=3659 GN=Csa_7G395260 PE=3 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 3.0e-13 Identity = 47/80 (58.75%), Postives = 55/80 (68.75%), Query Frame = 0
BLAST of MELO3C028950.2 vs. TrEMBL
Match: tr|A0A2I4FE24|A0A2I4FE24_9ROSI (Potassium transporter OS=Juglans regia OX=51240 GN=LOC108997954 PE=3 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 4.0e-13 Identity = 48/79 (60.76%), Postives = 55/79 (69.62%), Query Frame = 0
BLAST of MELO3C028950.2 vs. TrEMBL
Match: tr|A0A2P4HVX1|A0A2P4HVX1_QUESU (Potassium transporter OS=Quercus suber OX=58331 GN=CFP56_45618 PE=3 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 5.2e-13 Identity = 48/79 (60.76%), Postives = 54/79 (68.35%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|