MELO3C028915.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.TGAAATTACATCTTCTAACTCTCGGTTAATTGAATCCCCCTCTCCTGGTATTACTTCGAGACGTTTCGTATACGAGTCTCTTCAAACAGGACTTATTGCTATTGATACAATGATTCCTGTCGACGTGGTCAGCAATAATTAATTAT TGAAATTACATCTTCTAACTCTCGGTTAATTGAATCCCCCTCTCCTGGTATTACTTCGAGACGTTTCGTATACGAGTCTCTTCAAACAGGACTTATTGCTATTGATACAATGATTCCTGTCGACGTGGTCAGCAATAATTAATTAT GAAATTACATCTTCTAACTCTCGGTTAATTGAATCCCCCTCTCCTGGTATTACTTCGAGACGTTTCGTATACGAGTCTCTTCAAACAGGACTTATTGCTATTGATACAATGATTCCTGTCGACGTGGTCAGCAATAATTAA EITSSNSRLIESPSPGITSRRFVYESLQTGLIAIDTMIPVDVVSNN
BLAST of MELO3C028915.2 vs. NCBI nr
Match: YP_009270544.1 (ATP synthase CF1 subunit alpha (chloroplast) [Apostasia odorata] >AEJ10061.1 ATP synthase CF1 alpha subunit, partial (plastid) [Apostasia wallichii] >AIY61265.1 ATP synthase CF1 subunit alpha (chloroplast) [Apostasia odorata]) HSP 1 Score: 65.5 bits (158), Expect = 5.5e-08 Identity = 32/40 (80.00%), Postives = 37/40 (92.50%), Query Frame = 0
BLAST of MELO3C028915.2 vs. NCBI nr
Match: YP_008994380.1 (ATP synthase CF1 alpha subunit (chloroplast) [Viviania marifolia] >AGV02809.1 ATP synthase CF1 alpha subunit (chloroplast) [Viviania marifolia]) HSP 1 Score: 65.5 bits (158), Expect = 5.5e-08 Identity = 32/40 (80.00%), Postives = 35/40 (87.50%), Query Frame = 0
BLAST of MELO3C028915.2 vs. NCBI nr
Match: ADD31505.1 (ATP synthase CF1 alpha subunit protein (chloroplast) [Euonymus americanus]) HSP 1 Score: 65.5 bits (158), Expect = 5.5e-08 Identity = 32/40 (80.00%), Postives = 37/40 (92.50%), Query Frame = 0
BLAST of MELO3C028915.2 vs. NCBI nr
Match: YP_009171669.1 (ATP synthase CF1 alpha subunit (chloroplast) [Euonymus japonicus] >YP_009433503.1 ATP synthase CF1 alpha subunit (chloroplast) [Euonymus schensianus] >AKF33707.1 ATP synthase CF1 alpha subunit (chloroplast) [Euonymus japonicus] >ATD85415.1 ATP synthase CF1 alpha subunit (chloroplast) [Euonymus schensianus]) HSP 1 Score: 65.5 bits (158), Expect = 5.5e-08 Identity = 32/40 (80.00%), Postives = 37/40 (92.50%), Query Frame = 0
BLAST of MELO3C028915.2 vs. NCBI nr
Match: YP_009390711.1 (ATP synthase CF1 alpha subunit (chloroplast) [Mangifera indica] >ARH53526.1 ATP synthase CF1 alpha subunit (chloroplast) [Mangifera indica] >ARV87174.1 ATP synthase CF1 alpha subunit (chloroplast) [Mangifera indica]) HSP 1 Score: 65.5 bits (158), Expect = 5.5e-08 Identity = 32/40 (80.00%), Postives = 37/40 (92.50%), Query Frame = 0
BLAST of MELO3C028915.2 vs. TAIR10
Match: ATCG00120.1 (ATP synthase subunit alpha) HSP 1 Score: 62.0 bits (149), Expect = 1.1e-10 Identity = 30/40 (75.00%), Postives = 36/40 (90.00%), Query Frame = 0
BLAST of MELO3C028915.2 vs. Swiss-Prot
Match: sp|P06450|ATPA_SPIOL (ATP synthase subunit alpha, chloroplastic OS=Spinacia oleracea OX=3562 GN=atpA PE=1 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 2.4e-10 Identity = 33/40 (82.50%), Postives = 35/40 (87.50%), Query Frame = 0
BLAST of MELO3C028915.2 vs. Swiss-Prot
Match: sp|Q70XV0|ATPA_AMBTC (ATP synthase subunit alpha, chloroplastic OS=Amborella trichopoda OX=13333 GN=atpA PE=3 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 3.1e-10 Identity = 32/40 (80.00%), Postives = 36/40 (90.00%), Query Frame = 0
BLAST of MELO3C028915.2 vs. Swiss-Prot
Match: sp|Q9BBS3|ATPA_LOTJA (ATP synthase subunit alpha, chloroplastic OS=Lotus japonicus OX=34305 GN=atpA PE=3 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 3.1e-10 Identity = 32/40 (80.00%), Postives = 36/40 (90.00%), Query Frame = 0
BLAST of MELO3C028915.2 vs. Swiss-Prot
Match: sp|Q3BAQ7|ATPA_PHAAO (ATP synthase subunit alpha, chloroplastic OS=Phalaenopsis aphrodite subsp. formosana OX=308872 GN=atpA PE=3 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 3.1e-10 Identity = 32/40 (80.00%), Postives = 36/40 (90.00%), Query Frame = 0
BLAST of MELO3C028915.2 vs. Swiss-Prot
Match: sp|B0Z4N2|ATPA_OENAR (ATP synthase subunit alpha, chloroplastic OS=Oenothera argillicola OX=3940 GN=atpA PE=3 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 4.0e-10 Identity = 32/40 (80.00%), Postives = 35/40 (87.50%), Query Frame = 0
BLAST of MELO3C028915.2 vs. TrEMBL
Match: tr|A0A1Z1GA95|A0A1Z1GA95_MANIN (ATP synthase subunit alpha, chloroplastic OS=Mangifera indica OX=29780 GN=atpA PE=3 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 3.6e-08 Identity = 32/40 (80.00%), Postives = 37/40 (92.50%), Query Frame = 0
BLAST of MELO3C028915.2 vs. TrEMBL
Match: tr|A0A0U2A0X9|A0A0U2A0X9_9ROSI (ATP synthase subunit alpha, chloroplastic OS=Euonymus japonicus OX=212708 GN=atpA PE=3 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 3.6e-08 Identity = 32/40 (80.00%), Postives = 37/40 (92.50%), Query Frame = 0
BLAST of MELO3C028915.2 vs. TrEMBL
Match: tr|A0A2R4QI88|A0A2R4QI88_9ROSI (ATP synthase subunit alpha, chloroplastic OS=Euonymus hamiltonianus OX=408194 GN=atpA PE=3 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 3.6e-08 Identity = 32/40 (80.00%), Postives = 37/40 (92.50%), Query Frame = 0
BLAST of MELO3C028915.2 vs. TrEMBL
Match: tr|D3WDQ2|D3WDQ2_9ROSI (ATP synthase subunit alpha, chloroplastic OS=Euonymus americanus OX=473042 GN=atpA PE=3 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 3.6e-08 Identity = 32/40 (80.00%), Postives = 37/40 (92.50%), Query Frame = 0
BLAST of MELO3C028915.2 vs. TrEMBL
Match: tr|A0A1C6ZUT0|A0A1C6ZUT0_9ASPA (ATP synthase subunit alpha, chloroplastic OS=Apostasia odorata OX=280455 GN=atpA PE=3 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 3.6e-08 Identity = 32/40 (80.00%), Postives = 37/40 (92.50%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |