MELO3C027025 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.TCAACATAACAAATGCTCTAACACATAAGGATCAACTCACCGTTCATTGCAAATCTGGCGATGACGACTTGGGAATCCACCAGCTGCAGCCTTTGGGTGGCTACGCCTTCACTTTTCGACCAGACTTCATTGGTACAACATTGTTTTACTGTACCTTCCAGTGGCCTGGTTGGTCACATAGCTTCGACATTTACAAGGATTCAAGAGATAGAGATCGTTGCAACGGTCTTTGTTTGTGGATTGTGGGTGAACAAGGTGTCT TCAACATAACAAATGCTCTAACACATAAGGATCAACTCACCGTTCATTGCAAATCTGGCGATGACGACTTGGGAATCCACCAGCTGCAGCCTTTGGGTGGCTACGCCTTCACTTTTCGACCAGACTTCATTGGTACAACATTGTTTTACTGTACCTTCCAGTGGCCTGGTTGGTCACATAGCTTCGACATTTACAAGGATTCAAGAGATAGAGATCGTTGCAACGGTCTTTGTTTGTGGATTGTGGGTGAACAAGGTGTCT TCAACATAACAAATGCTCTAACACATAAGGATCAACTCACCGTTCATTGCAAATCTGGCGATGACGACTTGGGAATCCACCAGCTGCAGCCTTTGGGTGGCTACGCCTTCACTTTTCGACCAGACTTCATTGGTACAACATTGTTTTACTGTACCTTCCAGTGGCCTGGTTGGTCACATAGCTTCGACATTTACAAGGATTCAAGAGATAGAGATCGTTGCAACGGTCTTTGTTTGTGGATTGTGGGTGAACAAGGTGTCT NITNALTHKDQLTVHCKSGDDDLGIHQLQPLGGYAFTFRPDFIGTTLFYCTFQWPGWSHSFDIYKDSRDRDRCNGLCLWIVGEQGV
BLAST of MELO3C027025 vs. TrEMBL
Match: A0A0A0LI28_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G162130 PE=4 SV=1) HSP 1 Score: 128.3 bits (321), Expect = 4.6e-27 Identity = 60/88 (68.18%), Postives = 69/88 (78.41%), Query Frame = 1
BLAST of MELO3C027025 vs. TrEMBL
Match: M5XJY5_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa019850mg PE=4 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 6.1e-19 Identity = 48/85 (56.47%), Postives = 60/85 (70.59%), Query Frame = 1
BLAST of MELO3C027025 vs. TrEMBL
Match: A0A059B0M4_EUCGR (Uncharacterized protein (Fragment) OS=Eucalyptus grandis GN=EUGRSUZ_H01885 PE=4 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 5.1e-18 Identity = 44/84 (52.38%), Postives = 57/84 (67.86%), Query Frame = 1
BLAST of MELO3C027025 vs. TrEMBL
Match: M5XR83_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa018418mg PE=4 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 1.1e-17 Identity = 44/85 (51.76%), Postives = 55/85 (64.71%), Query Frame = 1
BLAST of MELO3C027025 vs. TrEMBL
Match: V7D2M7_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_L001600g PE=4 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 1.5e-17 Identity = 43/84 (51.19%), Postives = 57/84 (67.86%), Query Frame = 1
BLAST of MELO3C027025 vs. TAIR10
Match: AT5G12060.1 (AT5G12060.1 Plant self-incompatibility protein S1 family) HSP 1 Score: 88.2 bits (217), Expect = 2.7e-18 Identity = 44/87 (50.57%), Postives = 50/87 (57.47%), Query Frame = 1
BLAST of MELO3C027025 vs. TAIR10
Match: AT4G16195.1 (AT4G16195.1 Plant self-incompatibility protein S1 family) HSP 1 Score: 83.2 bits (204), Expect = 8.7e-17 Identity = 41/88 (46.59%), Postives = 52/88 (59.09%), Query Frame = 1
BLAST of MELO3C027025 vs. TAIR10
Match: AT5G12070.1 (AT5G12070.1 Plant self-incompatibility protein S1 family) HSP 1 Score: 83.2 bits (204), Expect = 8.7e-17 Identity = 42/88 (47.73%), Postives = 50/88 (56.82%), Query Frame = 1
BLAST of MELO3C027025 vs. TAIR10
Match: AT3G17080.1 (AT3G17080.1 Plant self-incompatibility protein S1 family) HSP 1 Score: 73.9 bits (180), Expect = 5.3e-14 Identity = 32/57 (56.14%), Postives = 35/57 (61.40%), Query Frame = 1
BLAST of MELO3C027025 vs. TAIR10
Match: AT1G04645.1 (AT1G04645.1 Plant self-incompatibility protein S1 family) HSP 1 Score: 71.2 bits (173), Expect = 3.4e-13 Identity = 34/74 (45.95%), Postives = 42/74 (56.76%), Query Frame = 1
BLAST of MELO3C027025 vs. NCBI nr
Match: gi|659131194|ref|XP_008465559.1| (PREDICTED: uncharacterized protein LOC103503190, partial [Cucumis melo]) HSP 1 Score: 192.6 bits (488), Expect = 2.9e-46 Identity = 85/86 (98.84%), Postives = 86/86 (100.00%), Query Frame = 1
BLAST of MELO3C027025 vs. NCBI nr
Match: gi|659124055|ref|XP_008461966.1| (PREDICTED: uncharacterized protein LOC103500444 [Cucumis melo]) HSP 1 Score: 191.0 bits (484), Expect = 8.4e-46 Identity = 83/86 (96.51%), Postives = 86/86 (100.00%), Query Frame = 1
BLAST of MELO3C027025 vs. NCBI nr
Match: gi|659090020|ref|XP_008445791.1| (PREDICTED: uncharacterized protein LOC103488715 [Cucumis melo]) HSP 1 Score: 186.8 bits (473), Expect = 1.6e-44 Identity = 82/86 (95.35%), Postives = 85/86 (98.84%), Query Frame = 1
BLAST of MELO3C027025 vs. NCBI nr
Match: gi|659121602|ref|XP_008460741.1| (PREDICTED: uncharacterized protein LOC103499504 [Cucumis melo]) HSP 1 Score: 138.3 bits (347), Expect = 6.4e-30 Identity = 64/88 (72.73%), Postives = 72/88 (81.82%), Query Frame = 1
BLAST of MELO3C027025 vs. NCBI nr
Match: gi|700206411|gb|KGN61530.1| (hypothetical protein Csa_2G162130 [Cucumis sativus]) HSP 1 Score: 128.3 bits (321), Expect = 6.7e-27 Identity = 60/88 (68.18%), Postives = 69/88 (78.41%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|