MELO3C027024 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.GAGGAGGAGGAGGAGGACCACGACGGCAACGATGATGACGAGGATGGTGATGATGATGAGGATGAGGATGACGATGATGATGACGATGACGAGACGGCAACGATGATGACGAGGATGGTGATGATGATGAGGATGAGGATGACGATGATGATGACGATGACGATGATGATGATGATGTTGATGATGATGATGATTGAACCTGGTAATCAAAGAGATAGTGATATAGATGTAGAAGTTAATGAACTATTTGGTAACGAAGAAAAAAGAACGAAAGGATCCCTTCTGAGATATTTACACAAATAG GAGGAGGAGGAGGAGGACCACGACGGCAACGATGATGACGAGGATGGTGATGATGATGAGGATGAGGATGACGATGATGATGACGATGACGAGACGGCAACGATGATGACGAGGATGGTGATGATGATGAGGATGAGGATGACGATGATGATGACGATGACGATGATGATGATGATGTTGATGATGATGATGATTGAACCTGGTAATCAAAGAGATAGTGATATAGATGTAGAAGTTAATGAACTATTTGGTAACGAAGAAAAAAGAACGAAAGGATCCCTTCTGAGATATTTACACAAATAG GAGGAGGAGGAGGAGGACCACGACGGCAACGATGATGACGAGGATGGTGATGATGATGAGGATGAGGATGACGATGATGATGACGATGACGAGACGGCAACGATGATGACGAGGATGGTGATGATGATGAGGATGAGGATGACGATGATGATGACGATGACGATGATGATGATGATGTTGATGATGATGATGATTGAACCTGGTAATCAAAGAGATAGTGATATAGATGTAGAAGTTAATGAACTATTTGGTAACGAAGAAAAAAGAACGAAAGGATCCCTTCTGAGATATTTACACAAATAG EEEEEDHDGNDDDEDGDDDEDEDDDDDDDDETATMMTRMVMMMRMRMTMMMTMTMMMMMLMMMMIEPGNQRDSDIDVEVNELFGNEEKRTKGSLLRYLHK*
BLAST of MELO3C027024 vs. Swiss-Prot
Match: Y3096_DROME (Ribosomal L1 domain-containing protein CG13096 OS=Drosophila melanogaster GN=CG13096 PE=1 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 1.8e-07 Identity = 22/30 (73.33%), Postives = 26/30 (86.67%), Query Frame = 1
HSP 2 Score: 53.1 bits (126), Expect = 2.0e-06 Identity = 24/42 (57.14%), Postives = 28/42 (66.67%), Query Frame = 1
HSP 3 Score: 47.0 bits (110), Expect = 1.4e-04 Identity = 14/31 (45.16%), Postives = 27/31 (87.10%), Query Frame = 1
HSP 4 Score: 40.4 bits (93), Expect = 1.3e-02 Identity = 21/36 (58.33%), Postives = 23/36 (63.89%), Query Frame = 1
BLAST of MELO3C027024 vs. Swiss-Prot
Match: SHQ1_DROME (Protein SHQ1 homolog OS=Drosophila melanogaster GN=CG10055 PE=2 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 9.0e-07 Identity = 21/37 (56.76%), Postives = 28/37 (75.68%), Query Frame = 1
BLAST of MELO3C027024 vs. Swiss-Prot
Match: TIG_HERA2 (Trigger factor OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=tig PE=3 SV=1) HSP 1 Score: 52.0 bits (123), Expect = 4.5e-06 Identity = 18/36 (50.00%), Postives = 28/36 (77.78%), Query Frame = 1
HSP 2 Score: 42.7 bits (99), Expect = 2.7e-03 Identity = 15/25 (60.00%), Postives = 21/25 (84.00%), Query Frame = 1
BLAST of MELO3C027024 vs. Swiss-Prot
Match: TOP1_USTMA (DNA topoisomerase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=TOP1 PE=3 SV=2) HSP 1 Score: 51.6 bits (122), Expect = 5.8e-06 Identity = 21/49 (42.86%), Postives = 30/49 (61.22%), Query Frame = 1
HSP 2 Score: 40.8 bits (94), Expect = 1.0e-02 Identity = 13/25 (52.00%), Postives = 21/25 (84.00%), Query Frame = 1
BLAST of MELO3C027024 vs. Swiss-Prot
Match: ATAD2_PONAB (ATPase family AAA domain-containing protein 2 OS=Pongo abelii GN=ATAD2 PE=2 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 7.6e-06 Identity = 18/31 (58.06%), Postives = 26/31 (83.87%), Query Frame = 1
HSP 2 Score: 42.0 bits (97), Expect = 4.6e-03 Identity = 14/30 (46.67%), Postives = 22/30 (73.33%), Query Frame = 1
HSP 3 Score: 35.8 bits (81), Expect = 3.3e-01 Identity = 18/43 (41.86%), Postives = 24/43 (55.81%), Query Frame = 1
HSP 4 Score: 25.4 bits (54), Expect = 4.5e+02 Identity = 7/21 (33.33%), Postives = 14/21 (66.67%), Query Frame = 1
BLAST of MELO3C027024 vs. TrEMBL
Match: L1IUA1_GUITH (Uncharacterized protein OS=Guillardia theta CCMP2712 GN=GUITHDRAFT_114192 PE=4 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 5.7e-16 Identity = 40/65 (61.54%), Postives = 52/65 (80.00%), Query Frame = 1
BLAST of MELO3C027024 vs. TrEMBL
Match: L1IUA1_GUITH (Uncharacterized protein OS=Guillardia theta CCMP2712 GN=GUITHDRAFT_114192 PE=4 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 9.0e-14 Identity = 42/87 (48.28%), Postives = 56/87 (64.37%), Query Frame = 1
HSP 2 Score: 77.4 bits (189), Expect = 1.1e-11 Identity = 40/76 (52.63%), Postives = 47/76 (61.84%), Query Frame = 1
HSP 3 Score: 80.9 bits (198), Expect = 1.0e-12 Identity = 35/61 (57.38%), Postives = 48/61 (78.69%), Query Frame = 1
BLAST of MELO3C027024 vs. TrEMBL
Match: K4BGK5_SOLLC (Uncharacterized protein OS=Solanum lycopersicum PE=4 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 2.2e-12 Identity = 39/78 (50.00%), Postives = 51/78 (65.38%), Query Frame = 1
BLAST of MELO3C027024 vs. TrEMBL
Match: K4BGK5_SOLLC (Uncharacterized protein OS=Solanum lycopersicum PE=4 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 4.2e-11 Identity = 35/63 (55.56%), Postives = 45/63 (71.43%), Query Frame = 1
HSP 2 Score: 71.2 bits (173), Expect = 7.9e-10 Identity = 39/92 (42.39%), Postives = 51/92 (55.43%), Query Frame = 1
HSP 3 Score: 53.9 bits (128), Expect = 1.3e-04 Identity = 18/31 (58.06%), Postives = 29/31 (93.55%), Query Frame = 1
HSP 4 Score: 41.6 bits (96), Expect = 6.7e-01 Identity = 23/39 (58.97%), Postives = 26/39 (66.67%), Query Frame = 1
HSP 5 Score: 36.2 bits (82), Expect = 2.8e+01 Identity = 22/45 (48.89%), Postives = 24/45 (53.33%), Query Frame = 1
HSP 6 Score: 77.8 bits (190), Expect = 8.4e-12 Identity = 35/68 (51.47%), Postives = 51/68 (75.00%), Query Frame = 1
BLAST of MELO3C027024 vs. TrEMBL
Match: K4CCM1_SOLLC (Uncharacterized protein OS=Solanum lycopersicum PE=4 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 1.8e-09 Identity = 36/88 (40.91%), Postives = 54/88 (61.36%), Query Frame = 1
HSP 2 Score: 69.3 bits (168), Expect = 3.0e-09 Identity = 38/103 (36.89%), Postives = 57/103 (55.34%), Query Frame = 1
HSP 3 Score: 42.4 bits (98), Expect = 3.9e-01 Identity = 15/31 (48.39%), Postives = 25/31 (80.65%), Query Frame = 1
HSP 4 Score: 42.0 bits (97), Expect = 5.1e-01 Identity = 16/26 (61.54%), Postives = 20/26 (76.92%), Query Frame = 1
HSP 5 Score: 40.0 bits (92), Expect = 2.0e+00 Identity = 17/36 (47.22%), Postives = 24/36 (66.67%), Query Frame = 1
HSP 6 Score: 38.9 bits (89), Expect = 4.3e+00 Identity = 17/38 (44.74%), Postives = 24/38 (63.16%), Query Frame = 1
HSP 7 Score: 37.7 bits (86), Expect = 9.7e+00 Identity = 19/45 (42.22%), Postives = 26/45 (57.78%), Query Frame = 1
HSP 8 Score: 37.4 bits (85), Expect = 1.3e+01 Identity = 13/22 (59.09%), Postives = 19/22 (86.36%), Query Frame = 1
HSP 9 Score: 76.3 bits (186), Expect = 2.5e-11 Identity = 38/71 (53.52%), Postives = 48/71 (67.61%), Query Frame = 1
BLAST of MELO3C027024 vs. TAIR10
Match: AT5G42280.1 (AT5G42280.1 Cysteine/Histidine-rich C1 domain family protein) HSP 1 Score: 53.5 bits (127), Expect = 8.6e-08 Identity = 27/48 (56.25%), Postives = 32/48 (66.67%), Query Frame = 1
HSP 2 Score: 50.4 bits (119), Expect = 7.3e-07 Identity = 27/55 (49.09%), Postives = 35/55 (63.64%), Query Frame = 1
BLAST of MELO3C027024 vs. TAIR10
Match: AT1G47970.1 (AT1G47970.1 unknown protein) HSP 1 Score: 52.0 bits (123), Expect = 2.5e-07 Identity = 20/31 (64.52%), Postives = 26/31 (83.87%), Query Frame = 1
HSP 2 Score: 45.4 bits (106), Expect = 2.4e-05 Identity = 17/29 (58.62%), Postives = 21/29 (72.41%), Query Frame = 1
HSP 3 Score: 45.1 bits (105), Expect = 3.1e-05 Identity = 16/27 (59.26%), Postives = 22/27 (81.48%), Query Frame = 1
HSP 4 Score: 40.4 bits (93), Expect = 7.6e-04 Identity = 14/29 (48.28%), Postives = 21/29 (72.41%), Query Frame = 1
HSP 5 Score: 39.3 bits (90), Expect = 1.7e-03 Identity = 16/27 (59.26%), Postives = 21/27 (77.78%), Query Frame = 1
BLAST of MELO3C027024 vs. TAIR10
Match: AT5G63740.1 (AT5G63740.1 RING/U-box superfamily protein) HSP 1 Score: 48.9 bits (115), Expect = 2.1e-06 Identity = 20/32 (62.50%), Postives = 26/32 (81.25%), Query Frame = 1
HSP 2 Score: 43.9 bits (102), Expect = 6.8e-05 Identity = 20/33 (60.61%), Postives = 22/33 (66.67%), Query Frame = 1
HSP 3 Score: 43.1 bits (100), Expect = 1.2e-04 Identity = 21/39 (53.85%), Postives = 23/39 (58.97%), Query Frame = 1
HSP 4 Score: 39.7 bits (91), Expect = 1.3e-03 Identity = 19/46 (41.30%), Postives = 23/46 (50.00%), Query Frame = 1
HSP 5 Score: 37.0 bits (84), Expect = 8.4e-03 Identity = 11/37 (29.73%), Postives = 26/37 (70.27%), Query Frame = 1
BLAST of MELO3C027024 vs. TAIR10
Match: AT5G37430.1 (AT5G37430.1 Family of unknown function (DUF577)) HSP 1 Score: 48.5 bits (114), Expect = 2.8e-06 Identity = 18/30 (60.00%), Postives = 23/30 (76.67%), Query Frame = 1
HSP 2 Score: 48.1 bits (113), Expect = 3.6e-06 Identity = 17/31 (54.84%), Postives = 24/31 (77.42%), Query Frame = 1
HSP 3 Score: 46.6 bits (109), Expect = 1.1e-05 Identity = 17/29 (58.62%), Postives = 22/29 (75.86%), Query Frame = 1
HSP 4 Score: 45.4 bits (106), Expect = 2.4e-05 Identity = 16/31 (51.61%), Postives = 23/31 (74.19%), Query Frame = 1
HSP 5 Score: 43.9 bits (102), Expect = 6.8e-05 Identity = 16/29 (55.17%), Postives = 21/29 (72.41%), Query Frame = 1
HSP 6 Score: 36.6 bits (83), Expect = 1.1e-02 Identity = 14/21 (66.67%), Postives = 15/21 (71.43%), Query Frame = 1
BLAST of MELO3C027024 vs. TAIR10
Match: AT3G59020.2 (AT3G59020.2 ARM repeat superfamily protein) HSP 1 Score: 48.1 bits (113), Expect = 3.6e-06 Identity = 23/34 (67.65%), Postives = 24/34 (70.59%), Query Frame = 1
HSP 2 Score: 43.9 bits (102), Expect = 6.8e-05 Identity = 20/39 (51.28%), Postives = 26/39 (66.67%), Query Frame = 1
BLAST of MELO3C027024 vs. NCBI nr
Match: gi|551647787|ref|XP_005826677.1| (hypothetical protein GUITHDRAFT_114192 [Guillardia theta CCMP2712]) HSP 1 Score: 91.7 bits (226), Expect = 8.1e-16 Identity = 40/65 (61.54%), Postives = 52/65 (80.00%), Query Frame = 1
BLAST of MELO3C027024 vs. NCBI nr
Match: gi|551647787|ref|XP_005826677.1| (hypothetical protein GUITHDRAFT_114192 [Guillardia theta CCMP2712]) HSP 1 Score: 84.3 bits (207), Expect = 1.3e-13 Identity = 42/87 (48.28%), Postives = 56/87 (64.37%), Query Frame = 1
HSP 2 Score: 77.4 bits (189), Expect = 1.6e-11 Identity = 40/76 (52.63%), Postives = 47/76 (61.84%), Query Frame = 1
HSP 3 Score: 73.6 bits (179), Expect = 2.3e-10 Identity = 36/70 (51.43%), Postives = 50/70 (71.43%), Query Frame = 1
BLAST of MELO3C027024 vs. NCBI nr
Match: gi|999972953|gb|KXJ12127.1| (hypothetical protein AC249_AIPGENE5692 [Exaiptasia pallida]) HSP 1 Score: 70.5 bits (171), Expect = 1.9e-09 Identity = 36/87 (41.38%), Postives = 50/87 (57.47%), Query Frame = 1
HSP 2 Score: 66.6 bits (161), Expect = 2.8e-08 Identity = 34/78 (43.59%), Postives = 50/78 (64.10%), Query Frame = 1
HSP 3 Score: 47.0 bits (110), Expect = 2.3e-02 Identity = 17/27 (62.96%), Postives = 24/27 (88.89%), Query Frame = 1
HSP 4 Score: 31.2 bits (69), Expect = 1.3e+03 Identity = 13/21 (61.90%), Postives = 16/21 (76.19%), Query Frame = 1
HSP 5 Score: 72.0 bits (175), Expect = 6.7e-10 Identity = 33/66 (50.00%), Postives = 44/66 (66.67%), Query Frame = 1
BLAST of MELO3C027024 vs. NCBI nr
Match: gi|551640221|ref|XP_005822916.1| (hypothetical protein GUITHDRAFT_117848 [Guillardia theta CCMP2712]) HSP 1 Score: 64.3 bits (155), Expect = 1.4e-07 Identity = 33/81 (40.74%), Postives = 45/81 (55.56%), Query Frame = 1
HSP 2 Score: 57.8 bits (138), Expect = 1.3e-05 Identity = 33/92 (35.87%), Postives = 44/92 (47.83%), Query Frame = 1
HSP 3 Score: 44.7 bits (104), Expect = 1.1e-01 Identity = 17/24 (70.83%), Postives = 21/24 (87.50%), Query Frame = 1
HSP 4 Score: 39.3 bits (90), Expect = 4.8e+00 Identity = 17/27 (62.96%), Postives = 20/27 (74.07%), Query Frame = 1
HSP 5 Score: 71.6 bits (174), Expect = 8.7e-10 Identity = 30/65 (46.15%), Postives = 50/65 (76.92%), Query Frame = 1
BLAST of MELO3C027024 vs. NCBI nr
Match: gi|669303846|gb|KFD47439.1| (hypothetical protein M513_11664 [Trichuris suis]) HSP 1 Score: 64.3 bits (155), Expect = 1.4e-07 Identity = 29/72 (40.28%), Postives = 51/72 (70.83%), Query Frame = 1
HSP 2 Score: 63.9 bits (154), Expect = 1.8e-07 Identity = 27/65 (41.54%), Postives = 47/65 (72.31%), Query Frame = 1
HSP 3 Score: 61.6 bits (148), Expect = 9.0e-07 Identity = 29/81 (35.80%), Postives = 51/81 (62.96%), Query Frame = 1
HSP 4 Score: 70.5 bits (171), Expect = 1.9e-09 Identity = 33/64 (51.56%), Postives = 51/64 (79.69%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|