MELO3C027015 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATTGTTGGTCCCTTTCTCTCCCTCTCGACGACGAGTTCAAGAAGCTCGTCAATCGTATGAACCCTCCCAGGTTTCTTTTTCTCTTTAATCTTCGATTTTCATTATGGGTTTTGTTTACTCTGTTTCTTTTCTTAAATGGGTTTTGTTTTCCAGGGTTACTATTGATAATGATTCCAGCAGAAAAGCTACTCCGATTAAGGTCAATTTTTTTTTAACTACTTCAATTCTTATTTTCAAGATGGGTTTTGGGTTTTTTCTAATTGGAATTGAGTTGTGAAATTTTTCAGGTTGATAGTGCTAATAAGCGAGGGAGTTTACTGGAAGTGGTTCAGGTTCTTAATGATTTGAATCTCATAATTAGACGAGCTTACATAGTTATTTGCCTCAGTTAG ATGGATTGTTGGTCCCTTTCTCTCCCTCTCGACGACGAGTTCAAGAAGCTCGTCAATCGTATGAACCCTCCCAGGGTTACTATTGATAATGATTCCAGCAGAAAAGCTACTCCGATTAAGGTTGATAGTGCTAATAAGCGAGGGAGTTTACTGGAAGTGGTTCAGGTTCTTAATGATTTGAATCTCATAATTAGACGAGCTTACATAGTTATTTGCCTCAGTTAG ATGGATTGTTGGTCCCTTTCTCTCCCTCTCGACGACGAGTTCAAGAAGCTCGTCAATCGTATGAACCCTCCCAGGGTTACTATTGATAATGATTCCAGCAGAAAAGCTACTCCGATTAAGGTTGATAGTGCTAATAAGCGAGGGAGTTTACTGGAAGTGGTTCAGGTTCTTAATGATTTGAATCTCATAATTAGACGAGCTTACATAGTTATTTGCCTCAGTTAG MDCWSLSLPLDDEFKKLVNRMNPPRVTIDNDSSRKATPIKVDSANKRGSLLEVVQVLNDLNLIIRRAYIVICLS*
BLAST of MELO3C027015 vs. Swiss-Prot
Match: ACR4_ARATH (ACT domain-containing protein ACR4 OS=Arabidopsis thaliana GN=ACR4 PE=2 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 3.2e-17 Identity = 43/65 (66.15%), Postives = 51/65 (78.46%), Query Frame = 1
BLAST of MELO3C027015 vs. Swiss-Prot
Match: ACR6_ARATH (ACT domain-containing protein ACR6 OS=Arabidopsis thaliana GN=ACR6 PE=2 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 2.1e-16 Identity = 40/59 (67.80%), Postives = 48/59 (81.36%), Query Frame = 1
BLAST of MELO3C027015 vs. Swiss-Prot
Match: ACR5_ARATH (ACT domain-containing protein ACR5 OS=Arabidopsis thaliana GN=ACR5 PE=2 SV=2) HSP 1 Score: 83.6 bits (205), Expect = 1.0e-15 Identity = 41/67 (61.19%), Postives = 47/67 (70.15%), Query Frame = 1
BLAST of MELO3C027015 vs. Swiss-Prot
Match: ACR1_ARATH (ACT domain-containing protein ACR1 OS=Arabidopsis thaliana GN=ACR1 PE=2 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 4.8e-13 Identity = 36/60 (60.00%), Postives = 44/60 (73.33%), Query Frame = 1
BLAST of MELO3C027015 vs. Swiss-Prot
Match: ACR3_ARATH (ACT domain-containing protein ACR3 OS=Arabidopsis thaliana GN=ACR3 PE=2 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 6.9e-12 Identity = 35/59 (59.32%), Postives = 43/59 (72.88%), Query Frame = 1
BLAST of MELO3C027015 vs. TrEMBL
Match: A0A0A0KC82_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G093100 PE=4 SV=1) HSP 1 Score: 134.0 bits (336), Expect = 7.4e-29 Identity = 66/69 (95.65%), Postives = 68/69 (98.55%), Query Frame = 1
BLAST of MELO3C027015 vs. TrEMBL
Match: A0A067K3L6_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_18003 PE=4 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 3.5e-23 Identity = 58/69 (84.06%), Postives = 63/69 (91.30%), Query Frame = 1
BLAST of MELO3C027015 vs. TrEMBL
Match: A0A061E404_THECC (ACT domain repeat 4 isoform 1 OS=Theobroma cacao GN=TCM_008595 PE=4 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 4.6e-23 Identity = 58/69 (84.06%), Postives = 63/69 (91.30%), Query Frame = 1
BLAST of MELO3C027015 vs. TrEMBL
Match: A0A061E468_THECC (ACT domain repeat 4 isoform 2 OS=Theobroma cacao GN=TCM_008595 PE=4 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 4.6e-23 Identity = 58/69 (84.06%), Postives = 63/69 (91.30%), Query Frame = 1
BLAST of MELO3C027015 vs. TrEMBL
Match: A0A0J8EW02_BETVU (Uncharacterized protein OS=Beta vulgaris subsp. vulgaris GN=BVRB_6g150360 PE=4 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 6.0e-23 Identity = 56/69 (81.16%), Postives = 62/69 (89.86%), Query Frame = 1
BLAST of MELO3C027015 vs. TAIR10
Match: AT1G69040.2 (AT1G69040.2 ACT domain repeat 4) HSP 1 Score: 88.6 bits (218), Expect = 1.8e-18 Identity = 43/65 (66.15%), Postives = 51/65 (78.46%), Query Frame = 1
BLAST of MELO3C027015 vs. TAIR10
Match: AT3G01990.1 (AT3G01990.1 ACT domain repeat 6) HSP 1 Score: 85.9 bits (211), Expect = 1.2e-17 Identity = 40/59 (67.80%), Postives = 48/59 (81.36%), Query Frame = 1
BLAST of MELO3C027015 vs. TAIR10
Match: AT2G03730.1 (AT2G03730.1 ACT domain repeat 5) HSP 1 Score: 83.6 bits (205), Expect = 5.8e-17 Identity = 41/67 (61.19%), Postives = 47/67 (70.15%), Query Frame = 1
BLAST of MELO3C027015 vs. TAIR10
Match: AT5G65890.1 (AT5G65890.1 ACT domain repeat 1) HSP 1 Score: 74.7 bits (182), Expect = 2.7e-14 Identity = 36/60 (60.00%), Postives = 44/60 (73.33%), Query Frame = 1
BLAST of MELO3C027015 vs. TAIR10
Match: AT1G76990.1 (AT1G76990.1 ACT domain repeat 3) HSP 1 Score: 70.9 bits (172), Expect = 3.9e-13 Identity = 35/59 (59.32%), Postives = 43/59 (72.88%), Query Frame = 1
BLAST of MELO3C027015 vs. NCBI nr
Match: gi|659119858|ref|XP_008459880.1| (PREDICTED: uncharacterized protein LOC103498865 isoform X2 [Cucumis melo]) HSP 1 Score: 134.4 bits (337), Expect = 8.1e-29 Identity = 67/69 (97.10%), Postives = 68/69 (98.55%), Query Frame = 1
BLAST of MELO3C027015 vs. NCBI nr
Match: gi|659119856|ref|XP_008459879.1| (PREDICTED: uncharacterized protein LOC103498865 isoform X1 [Cucumis melo]) HSP 1 Score: 134.4 bits (337), Expect = 8.1e-29 Identity = 67/69 (97.10%), Postives = 68/69 (98.55%), Query Frame = 1
BLAST of MELO3C027015 vs. NCBI nr
Match: gi|449445562|ref|XP_004140541.1| (PREDICTED: ACT domain-containing protein ACR4-like [Cucumis sativus]) HSP 1 Score: 134.0 bits (336), Expect = 1.1e-28 Identity = 66/69 (95.65%), Postives = 68/69 (98.55%), Query Frame = 1
BLAST of MELO3C027015 vs. NCBI nr
Match: gi|747079289|ref|XP_011086839.1| (PREDICTED: uncharacterized protein LOC105168447 isoform X2 [Sesamum indicum]) HSP 1 Score: 117.1 bits (292), Expect = 1.3e-23 Identity = 59/69 (85.51%), Postives = 62/69 (89.86%), Query Frame = 1
BLAST of MELO3C027015 vs. NCBI nr
Match: gi|502102404|ref|XP_004492064.1| (PREDICTED: ACT domain-containing protein ACR4-like [Cicer arietinum]) HSP 1 Score: 117.1 bits (292), Expect = 1.3e-23 Identity = 57/69 (82.61%), Postives = 62/69 (89.86%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |