MELO3C026989 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTAGCACTTTCCCTTTCTCCAATCCTCATCATTATACAGTTGGTCCACTTCACATGATGGTCAAACAAATTGAGGATGAAAAAACAAGAGCAGTAGGTTCAAATCTTTGGGTGGAGGAATATGAATGCATTGAATGGTTGAATTCAAAGGAACCCAATTCTGTGGTTTATGTTAACTTTGGTAGCATCATAGTGATGACAAAACAAGTAGTACTGAAGTTTCGGGCGCAAAAACCCCACATGGAAGAACATTAA ATGGCTAGCACTTTCCCTTTCTCCAATCCTCATCATTATACAGTTGGTCCACTTCACATGATGGTCAAACAAATTGAGGATGAAAAAACAAGAGCAGTAGGTTCAAATCTTTGGGTGGAGGAATATGAATGCATTGAATGGTTGAATTCAAAGGAACCCAATTCTGTGGTTTATGTTAACTTTGGTAGCATCATAGTGATGACAAAACAAGTAGTACTGAAGTTTCGGGCGCAAAAACCCCACATGGAAGAACATTAA ATGGCTAGCACTTTCCCTTTCTCCAATCCTCATCATTATACAGTTGGTCCACTTCACATGATGGTCAAACAAATTGAGGATGAAAAAACAAGAGCAGTAGGTTCAAATCTTTGGGTGGAGGAATATGAATGCATTGAATGGTTGAATTCAAAGGAACCCAATTCTGTGGTTTATGTTAACTTTGGTAGCATCATAGTGATGACAAAACAAGTAGTACTGAAGTTTCGGGCGCAAAAACCCCACATGGAAGAACATTAA MASTFPFSNPHHYTVGPLHMMVKQIEDEKTRAVGSNLWVEEYECIEWLNSKEPNSVVYVNFGSIIVMTKQVVLKFRAQKPHMEEH*
BLAST of MELO3C026989 vs. Swiss-Prot
Match: U85A8_STERE (UDP-glycosyltransferase 85A8 OS=Stevia rebaudiana GN=UGT85A8 PE=2 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 3.3e-18 Identity = 40/68 (58.82%), Postives = 53/68 (77.94%), Query Frame = 1
BLAST of MELO3C026989 vs. Swiss-Prot
Match: UGT2_GARJA (7-deoxyloganetin glucosyltransferase OS=Gardenia jasminoides GN=UGT85A24 PE=1 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 4.8e-17 Identity = 38/66 (57.58%), Postives = 50/66 (75.76%), Query Frame = 1
BLAST of MELO3C026989 vs. Swiss-Prot
Match: UGT6_CATRO (7-deoxyloganetin glucosyltransferase OS=Catharanthus roseus GN=UGT85A23 PE=1 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 6.2e-17 Identity = 37/66 (56.06%), Postives = 49/66 (74.24%), Query Frame = 1
BLAST of MELO3C026989 vs. Swiss-Prot
Match: U85C1_STERE (UDP-glycosyltransferase 85C1 OS=Stevia rebaudiana GN=UGT85C1 PE=2 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 2.6e-15 Identity = 36/66 (54.55%), Postives = 49/66 (74.24%), Query Frame = 1
BLAST of MELO3C026989 vs. Swiss-Prot
Match: U85A5_ARATH (UDP-glycosyltransferase 85A5 OS=Arabidopsis thaliana GN=UGT85A5 PE=2 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 1.7e-14 Identity = 35/68 (51.47%), Postives = 50/68 (73.53%), Query Frame = 1
BLAST of MELO3C026989 vs. TrEMBL
Match: A0A0A0K416_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G063980 PE=4 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 1.2e-19 Identity = 44/63 (69.84%), Postives = 56/63 (88.89%), Query Frame = 1
BLAST of MELO3C026989 vs. TrEMBL
Match: A0A151TZV7_CAJCA (Glycosyltransferase OS=Cajanus cajan GN=KK1_005173 PE=3 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 4.4e-17 Identity = 39/66 (59.09%), Postives = 56/66 (84.85%), Query Frame = 1
BLAST of MELO3C026989 vs. TrEMBL
Match: I3S0J5_MEDTR (Uncharacterized protein OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 7.4e-17 Identity = 39/66 (59.09%), Postives = 55/66 (83.33%), Query Frame = 1
BLAST of MELO3C026989 vs. TrEMBL
Match: I3SAL9_MEDTR (Uncharacterized protein OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 7.4e-17 Identity = 39/66 (59.09%), Postives = 55/66 (83.33%), Query Frame = 1
BLAST of MELO3C026989 vs. TrEMBL
Match: G7KBB5_MEDTR (UDP-glucosyltransferase family protein OS=Medicago truncatula GN=MTR_5g064240 PE=4 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 7.4e-17 Identity = 39/66 (59.09%), Postives = 55/66 (83.33%), Query Frame = 1
BLAST of MELO3C026989 vs. TAIR10
Match: AT1G22370.2 (AT1G22370.2 UDP-glucosyl transferase 85A5) HSP 1 Score: 79.7 bits (195), Expect = 9.6e-16 Identity = 35/68 (51.47%), Postives = 50/68 (73.53%), Query Frame = 1
BLAST of MELO3C026989 vs. TAIR10
Match: AT1G22380.1 (AT1G22380.1 UDP-glucosyl transferase 85A3) HSP 1 Score: 77.4 bits (189), Expect = 4.8e-15 Identity = 37/68 (54.41%), Postives = 46/68 (67.65%), Query Frame = 1
BLAST of MELO3C026989 vs. TAIR10
Match: AT1G22360.1 (AT1G22360.1 UDP-glucosyl transferase 85A2) HSP 1 Score: 74.7 bits (182), Expect = 3.1e-14 Identity = 35/68 (51.47%), Postives = 47/68 (69.12%), Query Frame = 1
BLAST of MELO3C026989 vs. TAIR10
Match: AT1G22340.1 (AT1G22340.1 UDP-glucosyl transferase 85A7) HSP 1 Score: 70.9 bits (172), Expect = 4.4e-13 Identity = 32/68 (47.06%), Postives = 48/68 (70.59%), Query Frame = 1
BLAST of MELO3C026989 vs. TAIR10
Match: AT1G22400.1 (AT1G22400.1 UDP-Glycosyltransferase superfamily protein) HSP 1 Score: 68.9 bits (167), Expect = 1.7e-12 Identity = 31/68 (45.59%), Postives = 49/68 (72.06%), Query Frame = 1
BLAST of MELO3C026989 vs. NCBI nr
Match: gi|659110376|ref|XP_008455194.1| (PREDICTED: UDP-glycosyltransferase 85A5-like [Cucumis melo]) HSP 1 Score: 136.0 bits (341), Expect = 3.2e-29 Identity = 63/75 (84.00%), Postives = 69/75 (92.00%), Query Frame = 1
BLAST of MELO3C026989 vs. NCBI nr
Match: gi|659110368|ref|XP_008455190.1| (PREDICTED: UDP-glycosyltransferase 85A5-like isoform X1 [Cucumis melo]) HSP 1 Score: 135.6 bits (340), Expect = 4.2e-29 Identity = 62/75 (82.67%), Postives = 70/75 (93.33%), Query Frame = 1
BLAST of MELO3C026989 vs. NCBI nr
Match: gi|659110348|ref|XP_008455180.1| (PREDICTED: UDP-glycosyltransferase 85A5-like [Cucumis melo]) HSP 1 Score: 134.4 bits (337), Expect = 9.3e-29 Identity = 61/75 (81.33%), Postives = 68/75 (90.67%), Query Frame = 1
BLAST of MELO3C026989 vs. NCBI nr
Match: gi|778730167|ref|XP_011659716.1| (PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Cucumis sativus]) HSP 1 Score: 129.8 bits (325), Expect = 2.3e-27 Identity = 61/76 (80.26%), Postives = 68/76 (89.47%), Query Frame = 1
BLAST of MELO3C026989 vs. NCBI nr
Match: gi|778724383|ref|XP_011658789.1| (PREDICTED: 7-deoxyloganetin glucosyltransferase-like isoform X2 [Cucumis sativus]) HSP 1 Score: 125.6 bits (314), Expect = 4.3e-26 Identity = 59/76 (77.63%), Postives = 67/76 (88.16%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|