MELO3C026987 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTATCTGATGATTTATGTATTGTAATTTGCTTTCTACATCACAATCATGCGTTGGACTATTACTTTTACATTATGGTTAGTTGAACTTGGATACAAAGATTGATCCAGCATTATATTTATTGGACTTTTGTTCATCTTCCGTAGTCCATGGTCTGTTTCTAGTTGTTCTTTCATTTTGCTTTTTTATATACGGGTCTTCTAACTAGTAAGTTTGAAGTGGATTCACATTTGGCTATGTTACAATCCTCTAGATTATCAGTTTGCGAGTGTGTGCATAGCTAATCTCAAATACAAAGACTAATCCAACAGAATATTTATTGGAATCTTATCGATCATTCTTAATCCATGGTCATTTCTAGTTGATCTTCCTTTTTTTTTTTTTTGGTCATTTAGATCATATCATGTTATTTATTTCCATCAGGACAAGTAAGGATAGGATGAAGGTATCAACAGTGGAAAAGGGTGAAAATACAGTTTTCACGATACCCTTAGAATTGGCCTATGGAGAGTTCAACTCTCCGCCAACAATTCCACTGAACGCTACTCTCCAATTTGATGTTGAGCTACTTTCATGGCATAGCGTCAAAGACATCTGTTAA ATGATGAAGGTATCAACAGTGGAAAAGGGTGAAAATACAGTTTTCACGATACCCTTAGAATTGGCCTATGGAGAGTTCAACTCTCCGCCAACAATTCCACTGAACGCTACTCTCCAATTTGATGTTGAGCTACTTTCATGGCATAGCGTCAAAGACATCTGTTAA ATGATGAAGGTATCAACAGTGGAAAAGGGTGAAAATACAGTTTTCACGATACCCTTAGAATTGGCCTATGGAGAGTTCAACTCTCCGCCAACAATTCCACTGAACGCTACTCTCCAATTTGATGTTGAGCTACTTTCATGGCATAGCGTCAAAGACATCTGTTAA MMKVSTVEKGENTVFTIPLELAYGEFNSPPTIPLNATLQFDVELLSWHSVKDIC*
BLAST of MELO3C026987 vs. Swiss-Prot
Match: FKB62_ARATH (Peptidyl-prolyl cis-trans isomerase FKBP62 OS=Arabidopsis thaliana GN=FKBP62 PE=1 SV=2) HSP 1 Score: 87.0 bits (214), Expect = 6.8e-17 Identity = 40/51 (78.43%), Postives = 41/51 (80.39%), Query Frame = 1
HSP 2 Score: 42.7 bits (99), Expect = 1.5e-03 Identity = 19/55 (34.55%), Postives = 32/55 (58.18%), Query Frame = 1
BLAST of MELO3C026987 vs. Swiss-Prot
Match: FKB65_ARATH (Peptidyl-prolyl cis-trans isomerase FKBP65 OS=Arabidopsis thaliana GN=FKBP65 PE=1 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 2.6e-16 Identity = 38/51 (74.51%), Postives = 42/51 (82.35%), Query Frame = 1
HSP 2 Score: 47.0 bits (110), Expect = 7.8e-05 Identity = 22/56 (39.29%), Postives = 33/56 (58.93%), Query Frame = 1
BLAST of MELO3C026987 vs. Swiss-Prot
Match: FKB70_WHEAT (70 kDa peptidyl-prolyl isomerase OS=Triticum aestivum GN=FKBP70 PE=1 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 2.9e-15 Identity = 38/50 (76.00%), Postives = 41/50 (82.00%), Query Frame = 1
HSP 2 Score: 40.0 bits (92), Expect = 9.5e-03 Identity = 19/55 (34.55%), Postives = 29/55 (52.73%), Query Frame = 1
BLAST of MELO3C026987 vs. TrEMBL
Match: A0A0A0L633_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G172920 PE=4 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 9.0e-16 Identity = 42/51 (82.35%), Postives = 45/51 (88.24%), Query Frame = 1
BLAST of MELO3C026987 vs. TrEMBL
Match: A0A078DDH5_BRANA (BnaC07g26590D protein OS=Brassica napus GN=BnaC07g26590D PE=4 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 1.5e-15 Identity = 42/53 (79.25%), Postives = 45/53 (84.91%), Query Frame = 1
BLAST of MELO3C026987 vs. TrEMBL
Match: A0A078DDH5_BRANA (BnaC07g26590D protein OS=Brassica napus GN=BnaC07g26590D PE=4 SV=1) HSP 1 Score: 40.8 bits (94), Expect = 6.2e-01 Identity = 19/56 (33.93%), Postives = 32/56 (57.14%), Query Frame = 1
HSP 2 Score: 89.4 bits (220), Expect = 1.5e-15 Identity = 42/53 (79.25%), Postives = 45/53 (84.91%), Query Frame = 1
BLAST of MELO3C026987 vs. TrEMBL
Match: A0A0D3DBT2_BRAOL (Uncharacterized protein OS=Brassica oleracea var. oleracea GN=ROF2 PE=4 SV=1) HSP 1 Score: 40.8 bits (94), Expect = 6.2e-01 Identity = 19/56 (33.93%), Postives = 32/56 (57.14%), Query Frame = 1
HSP 2 Score: 88.6 bits (218), Expect = 2.6e-15 Identity = 41/53 (77.36%), Postives = 45/53 (84.91%), Query Frame = 1
BLAST of MELO3C026987 vs. TrEMBL
Match: A0A078FPT3_BRANA (BnaC03g44570D protein OS=Brassica napus GN=BnaC03g44570D PE=4 SV=1) HSP 1 Score: 41.2 bits (95), Expect = 4.8e-01 Identity = 19/55 (34.55%), Postives = 33/55 (60.00%), Query Frame = 1
HSP 2 Score: 40.4 bits (93), Expect = 8.1e-01 Identity = 18/55 (32.73%), Postives = 32/55 (58.18%), Query Frame = 1
HSP 3 Score: 88.6 bits (218), Expect = 2.6e-15 Identity = 42/53 (79.25%), Postives = 45/53 (84.91%), Query Frame = 1
BLAST of MELO3C026987 vs. TAIR10
Match: AT3G25230.2 (AT3G25230.2 rotamase FKBP 1) HSP 1 Score: 87.0 bits (214), Expect = 3.8e-18 Identity = 40/51 (78.43%), Postives = 41/51 (80.39%), Query Frame = 1
HSP 2 Score: 42.7 bits (99), Expect = 8.3e-05 Identity = 19/55 (34.55%), Postives = 32/55 (58.18%), Query Frame = 1
BLAST of MELO3C026987 vs. TAIR10
Match: AT5G48570.1 (AT5G48570.1 FKBP-type peptidyl-prolyl cis-trans isomerase family protein) HSP 1 Score: 85.1 bits (209), Expect = 1.5e-17 Identity = 38/51 (74.51%), Postives = 42/51 (82.35%), Query Frame = 1
HSP 2 Score: 47.0 bits (110), Expect = 4.4e-06 Identity = 22/56 (39.29%), Postives = 33/56 (58.93%), Query Frame = 1
BLAST of MELO3C026987 vs. NCBI nr
Match: gi|778679239|ref|XP_011651108.1| (PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Cucumis sativus]) HSP 1 Score: 90.1 bits (222), Expect = 1.3e-15 Identity = 42/51 (82.35%), Postives = 45/51 (88.24%), Query Frame = 1
BLAST of MELO3C026987 vs. NCBI nr
Match: gi|659077136|ref|XP_008439052.1| (PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Cucumis melo]) HSP 1 Score: 89.7 bits (221), Expect = 1.7e-15 Identity = 41/51 (80.39%), Postives = 45/51 (88.24%), Query Frame = 1
BLAST of MELO3C026987 vs. NCBI nr
Match: gi|659077136|ref|XP_008439052.1| (PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Cucumis melo]) HSP 1 Score: 37.4 bits (85), Expect = 9.9e+00 Identity = 19/55 (34.55%), Postives = 30/55 (54.55%), Query Frame = 1
HSP 2 Score: 89.4 bits (220), Expect = 2.2e-15 Identity = 42/53 (79.25%), Postives = 45/53 (84.91%), Query Frame = 1
BLAST of MELO3C026987 vs. NCBI nr
Match: gi|923650668|ref|XP_013644316.1| (PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Brassica napus]) HSP 1 Score: 43.5 bits (101), Expect = 1.4e-01 Identity = 20/56 (35.71%), Postives = 34/56 (60.71%), Query Frame = 1
HSP 2 Score: 89.4 bits (220), Expect = 2.2e-15 Identity = 42/53 (79.25%), Postives = 45/53 (84.91%), Query Frame = 1
BLAST of MELO3C026987 vs. NCBI nr
Match: gi|674948197|emb|CDX85348.1| (BnaC07g26590D [Brassica napus]) HSP 1 Score: 40.8 bits (94), Expect = 8.9e-01 Identity = 19/56 (33.93%), Postives = 32/56 (57.14%), Query Frame = 1
HSP 2 Score: 89.4 bits (220), Expect = 2.2e-15 Identity = 42/53 (79.25%), Postives = 45/53 (84.91%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|