MELO3C026942.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.GACCTTTTCTGCTGTAGGTATGAATCCTACTATCATGGTTGTTAGCCTGGCTGTTGCAATTCTAGCTGCTATCAAGGTTGCTGGACATGAATCGAATGATATTTATCTTTTTGAGATAAAAAAGGTAACCTTACGTTTTCATCACTAGTAAGGCTTAAAGTTTGAACCTATTCAATACATGTTGGCTTACTCTAATGCACAACCTTTAACCTACAGGCATTTGCATCCCAATTTGTGTATTGTCGTAATAAGTTGGGGCTACATCCAGAAAAGATTAATGCCAATGGAGGAGCAATTACCATTGTACATCTACTGGGTGCAACAGGTATGTTTCAAATACAAATAGTTTCTATGGACCAACACTTCAAATATAAGATCCTGATGAGTTAG GACCTTTTCTGCTGTAGGTATGAATCCTACTATCATGGTTGTTAGCCTGGCTGTTGCAATTCTAGCTGCTATCAAGGTTGCTGGACATGAATCGAATGATATTTATCTTTTTGAGATAAAAAAGGCATTTGCATCCCAATTTGTGTATTGTCGTAATAAGTTGGGGCTACATCCAGAAAAGATTAATGCCAATGGAGGAGCAATTACCATTGTACATCTACTGGGTGCAACAGGTATGTTTCAAATACAAATAGTTTCTATGGACCAACACTTCAAATATAAGATCCTGATGAGTTAG ATGAATCCTACTATCATGGTTGTTAGCCTGGCTGTTGCAATTCTAGCTGCTATCAAGGTTGCTGGACATGAATCGAATGATATTTATCTTTTTGAGATAAAAAAGGCATTTGCATCCCAATTTGTGTATTGTCGTAATAAGTTGGGGCTACATCCAGAAAAGATTAATGCCAATGGAGGAGCAATTACCATTGTACATCTACTGGGTGCAACAGGTATGTTTCAAATACAAATAGTTTCTATGGACCAACACTTCAAATATAAGATCCTGATGAGTTAG MNPTIMVVSLAVAILAAIKVAGHESNDIYLFEIKKAFASQFVYCRNKLGLHPEKINANGGAITIVHLLGATGMFQIQIVSMDQHFKYKILMS
BLAST of MELO3C026942.2 vs. NCBI nr
Match: XP_016899862.1 (PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform X1 [Cucumis melo]) HSP 1 Score: 117.1 bits (292), Expect = 3.2e-23 Identity = 60/72 (83.33%), Postives = 62/72 (86.11%), Query Frame = 0
BLAST of MELO3C026942.2 vs. NCBI nr
Match: XP_016899863.1 (PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform X2 [Cucumis melo]) HSP 1 Score: 117.1 bits (292), Expect = 3.2e-23 Identity = 60/72 (83.33%), Postives = 62/72 (86.11%), Query Frame = 0
BLAST of MELO3C026942.2 vs. NCBI nr
Match: NP_001267690.1 (3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis sativus] >CAA47926.1 3-ketoacyl-CoA thiolase [Cucumis sativus] >KGN56763.1 hypothetical protein Csa_3G133140 [Cucumis sativus]) HSP 1 Score: 100.1 bits (248), Expect = 4.0e-18 Identity = 53/72 (73.61%), Postives = 57/72 (79.17%), Query Frame = 0
BLAST of MELO3C026942.2 vs. NCBI nr
Match: EFH65781.1 (hypothetical protein ARALYDRAFT_470458, partial [Arabidopsis lyrata subsp. lyrata]) HSP 1 Score: 99.0 bits (245), Expect = 9.0e-18 Identity = 51/72 (70.83%), Postives = 57/72 (79.17%), Query Frame = 0
BLAST of MELO3C026942.2 vs. NCBI nr
Match: XP_020867120.1 (3-ketoacyl-CoA thiolase 1, peroxisomal [Arabidopsis lyrata subsp. lyrata]) HSP 1 Score: 99.0 bits (245), Expect = 9.0e-18 Identity = 51/72 (70.83%), Postives = 57/72 (79.17%), Query Frame = 0
BLAST of MELO3C026942.2 vs. TAIR10
Match: AT1G04710.1 (peroxisomal 3-ketoacyl-CoA thiolase 4) HSP 1 Score: 96.7 bits (239), Expect = 8.1e-21 Identity = 51/72 (70.83%), Postives = 56/72 (77.78%), Query Frame = 0
BLAST of MELO3C026942.2 vs. TAIR10
Match: AT2G33150.1 (peroxisomal 3-ketoacyl-CoA thiolase 3) HSP 1 Score: 96.7 bits (239), Expect = 8.1e-21 Identity = 50/72 (69.44%), Postives = 57/72 (79.17%), Query Frame = 0
BLAST of MELO3C026942.2 vs. TAIR10
Match: AT5G48880.2 (peroxisomal 3-keto-acyl-CoA thiolase 2) HSP 1 Score: 77.0 bits (188), Expect = 6.6e-15 Identity = 42/72 (58.33%), Postives = 51/72 (70.83%), Query Frame = 0
BLAST of MELO3C026942.2 vs. TAIR10
Match: AT5G48230.2 (acetoacetyl-CoA thiolase 2) HSP 1 Score: 54.7 bits (130), Expect = 3.5e-08 Identity = 29/70 (41.43%), Postives = 43/70 (61.43%), Query Frame = 0
BLAST of MELO3C026942.2 vs. TAIR10
Match: AT5G47720.2 (Thiolase family protein) HSP 1 Score: 53.5 bits (127), Expect = 7.9e-08 Identity = 27/70 (38.57%), Postives = 46/70 (65.71%), Query Frame = 0
BLAST of MELO3C026942.2 vs. Swiss-Prot
Match: sp|Q8LF48|THIK1_ARATH (3-ketoacyl-CoA thiolase 1, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=KAT1 PE=1 SV=2) HSP 1 Score: 96.7 bits (239), Expect = 1.5e-19 Identity = 51/72 (70.83%), Postives = 56/72 (77.78%), Query Frame = 0
BLAST of MELO3C026942.2 vs. Swiss-Prot
Match: sp|Q56WD9|THIK2_ARATH (3-ketoacyl-CoA thiolase 2, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=PED1 PE=1 SV=2) HSP 1 Score: 96.7 bits (239), Expect = 1.5e-19 Identity = 50/72 (69.44%), Postives = 57/72 (79.17%), Query Frame = 0
BLAST of MELO3C026942.2 vs. Swiss-Prot
Match: sp|Q570C8|THIK5_ARATH (3-ketoacyl-CoA thiolase 5, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=KAT5 PE=1 SV=2) HSP 1 Score: 77.0 bits (188), Expect = 1.2e-13 Identity = 42/72 (58.33%), Postives = 51/72 (70.83%), Query Frame = 0
BLAST of MELO3C026942.2 vs. Swiss-Prot
Match: sp|Q921H8|THIKA_MOUSE (3-ketoacyl-CoA thiolase A, peroxisomal OS=Mus musculus OX=10090 GN=Acaa1a PE=1 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 3.0e-12 Identity = 39/74 (52.70%), Postives = 49/74 (66.22%), Query Frame = 0
BLAST of MELO3C026942.2 vs. Swiss-Prot
Match: sp|Q8VCH0|THIKB_MOUSE (3-ketoacyl-CoA thiolase B, peroxisomal OS=Mus musculus OX=10090 GN=Acaa1b PE=1 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 3.0e-12 Identity = 39/74 (52.70%), Postives = 49/74 (66.22%), Query Frame = 0
BLAST of MELO3C026942.2 vs. TrEMBL
Match: tr|A0A1S4DV65|A0A1S4DV65_CUCME (3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform X2 OS=Cucumis melo OX=3656 GN=LOC103487528 PE=4 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 2.1e-23 Identity = 60/72 (83.33%), Postives = 62/72 (86.11%), Query Frame = 0
BLAST of MELO3C026942.2 vs. TrEMBL
Match: tr|A0A1S4DV50|A0A1S4DV50_CUCME (3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform X1 OS=Cucumis melo OX=3656 GN=LOC103487528 PE=4 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 2.1e-23 Identity = 60/72 (83.33%), Postives = 62/72 (86.11%), Query Frame = 0
BLAST of MELO3C026942.2 vs. TrEMBL
Match: tr|Q08375|Q08375_CUCSA (Acetyl-CoA acyltransferase (3-ketoacyl-coa thiolase) OS=Cucumis sativus OX=3659 GN=Csa_3G133140 PE=2 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 2.7e-18 Identity = 53/72 (73.61%), Postives = 57/72 (79.17%), Query Frame = 0
BLAST of MELO3C026942.2 vs. TrEMBL
Match: tr|A0A1J3DCB2|A0A1J3DCB2_NOCCA (3-ketoacyl-CoA thiolase 2, peroxisomal (Fragment) OS=Noccaea caerulescens OX=107243 GN=GA_TR15339_c0_g1_i1_g.47029 PE=3 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 6.0e-18 Identity = 52/72 (72.22%), Postives = 58/72 (80.56%), Query Frame = 0
BLAST of MELO3C026942.2 vs. TrEMBL
Match: tr|D7KE71|D7KE71_ARALL (Uncharacterized protein (Fragment) OS=Arabidopsis lyrata subsp. lyrata OX=81972 GN=ARALYDRAFT_470458 PE=3 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 6.0e-18 Identity = 51/72 (70.83%), Postives = 57/72 (79.17%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|