MELO3C026942 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTTGTTAGCCTGGCTGTTGCAATTCTAGCTGCTATCAAGGTTGCTGGACATGAATCGAATGATATTTATCTTTTTGAGATAAAAAAGGTAACCTTACGTTTTCATCACTAGTAAGGCTTAAAGTTTGAACCTATTCAATACATGTTGGCTTACTCTAATGCACAACCTTTAACCTACAAAAAGGCATTTGCATCCCAATTTGTGTATTGTCGTAATAAGTTGGGGCTACATCCAGAAAAGATTAATGCCAATGGAGGAGCAATTACCATTGTACATCTACATGGTGCAACAG ATGGTTGTTAGCCTGGCTGTTGCAATTCTAGCTGCTATCAAGGTTGCTGGACATGAATCGAATGATATTTATCTTTTTGAGATAAAAAAGGCATTTGCATCCCAATTTGTGTATTGTCGTAATAAGTTGGGGCTACATCCAGAAAAGATTAATGCCAATGGAGGAGCAATTACCATTGTACATCTACATGGTGCAACAG ATGGTTGTTAGCCTGGCTGTTGCAATTCTAGCTGCTATCAAGGTTGCTGGACATGAATCGAATGATATTTATCTTTTTGAGATAAAAAAGGCATTTGCATCCCAATTTGTGTATTGTCGTAATAAGTTGGGGCTACATCCAGAAAAGATTAATGCCAATGGAGGAGCAATTACCATTGTACATCTACATGGTGCAACAG MVVSLAVAILAAIKVAGHESNDIYLFEIKKAFASQFVYCRNKLGLHPEKINANGGAITIVHLHGAT
BLAST of MELO3C026942 vs. Swiss-Prot
Match: THIK1_ARATH (3-ketoacyl-CoA thiolase 1, peroxisomal OS=Arabidopsis thaliana GN=KAT1 PE=2 SV=2) HSP 1 Score: 87.4 bits (215), Expect = 6.3e-17 Identity = 47/66 (71.21%), Postives = 48/66 (72.73%), Query Frame = 1
BLAST of MELO3C026942 vs. Swiss-Prot
Match: THIK2_ARATH (3-ketoacyl-CoA thiolase 2, peroxisomal OS=Arabidopsis thaliana GN=PED1 PE=1 SV=2) HSP 1 Score: 87.4 bits (215), Expect = 6.3e-17 Identity = 46/66 (69.70%), Postives = 49/66 (74.24%), Query Frame = 1
BLAST of MELO3C026942 vs. Swiss-Prot
Match: THIK5_ARATH (3-ketoacyl-CoA thiolase 5, peroxisomal OS=Arabidopsis thaliana GN=KAT5 PE=2 SV=2) HSP 1 Score: 68.2 bits (165), Expect = 3.9e-11 Identity = 39/66 (59.09%), Postives = 43/66 (65.15%), Query Frame = 1
BLAST of MELO3C026942 vs. Swiss-Prot
Match: THIKA_MOUSE (3-ketoacyl-CoA thiolase A, peroxisomal OS=Mus musculus GN=Acaa1a PE=1 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 9.7e-10 Identity = 35/66 (53.03%), Postives = 41/66 (62.12%), Query Frame = 1
BLAST of MELO3C026942 vs. Swiss-Prot
Match: THIKB_MOUSE (3-ketoacyl-CoA thiolase B, peroxisomal OS=Mus musculus GN=Acaa1b PE=1 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 9.7e-10 Identity = 35/66 (53.03%), Postives = 41/66 (62.12%), Query Frame = 1
BLAST of MELO3C026942 vs. TrEMBL
Match: Q08375_CUCSA (Acetyl-CoA acyltransferase (3-ketoacyl-coa thiolase) OS=Cucumis sativus GN=Csa_3G133140 PE=2 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 6.3e-16 Identity = 49/66 (74.24%), Postives = 51/66 (77.27%), Query Frame = 1
BLAST of MELO3C026942 vs. TrEMBL
Match: D7KE71_ARALL (Putative uncharacterized protein (Fragment) OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_470458 PE=3 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 1.4e-15 Identity = 47/66 (71.21%), Postives = 51/66 (77.27%), Query Frame = 1
BLAST of MELO3C026942 vs. TrEMBL
Match: P93112_9ROSI (3-ketoacyl-CoA thiolase OS=Cucurbita cv. Kurokawa Amakuri PE=2 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 1.8e-15 Identity = 48/66 (72.73%), Postives = 50/66 (75.76%), Query Frame = 1
BLAST of MELO3C026942 vs. TrEMBL
Match: A0A087HL12_ARAAL (Uncharacterized protein OS=Arabis alpina GN=AALP_AA1G042000 PE=3 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 1.8e-15 Identity = 48/66 (72.73%), Postives = 50/66 (75.76%), Query Frame = 1
BLAST of MELO3C026942 vs. TrEMBL
Match: D7LFQ1_ARALL (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_482251 PE=3 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 4.1e-15 Identity = 46/66 (69.70%), Postives = 52/66 (78.79%), Query Frame = 1
BLAST of MELO3C026942 vs. TAIR10
Match: AT1G04710.1 (AT1G04710.1 peroxisomal 3-ketoacyl-CoA thiolase 4) HSP 1 Score: 87.4 bits (215), Expect = 3.5e-18 Identity = 47/66 (71.21%), Postives = 48/66 (72.73%), Query Frame = 1
BLAST of MELO3C026942 vs. TAIR10
Match: AT2G33150.1 (AT2G33150.1 peroxisomal 3-ketoacyl-CoA thiolase 3) HSP 1 Score: 87.4 bits (215), Expect = 3.5e-18 Identity = 46/66 (69.70%), Postives = 49/66 (74.24%), Query Frame = 1
BLAST of MELO3C026942 vs. TAIR10
Match: AT5G48880.2 (AT5G48880.2 peroxisomal 3-keto-acyl-CoA thiolase 2) HSP 1 Score: 68.2 bits (165), Expect = 2.2e-12 Identity = 39/66 (59.09%), Postives = 43/66 (65.15%), Query Frame = 1
BLAST of MELO3C026942 vs. TAIR10
Match: AT5G48230.2 (AT5G48230.2 acetoacetyl-CoA thiolase 2) HSP 1 Score: 48.9 bits (115), Expect = 1.4e-06 Identity = 26/61 (42.62%), Postives = 37/61 (60.66%), Query Frame = 1
BLAST of MELO3C026942 vs. TAIR10
Match: AT5G47720.2 (AT5G47720.2 Thiolase family protein) HSP 1 Score: 47.0 bits (110), Expect = 5.3e-06 Identity = 24/61 (39.34%), Postives = 39/61 (63.93%), Query Frame = 1
BLAST of MELO3C026942 vs. NCBI nr
Match: gi|659086735|ref|XP_008444084.1| (PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform X1 [Cucumis melo]) HSP 1 Score: 107.5 bits (267), Expect = 9.3e-21 Identity = 55/66 (83.33%), Postives = 56/66 (84.85%), Query Frame = 1
BLAST of MELO3C026942 vs. NCBI nr
Match: gi|659086745|ref|XP_008444089.1| (PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform X2 [Cucumis melo]) HSP 1 Score: 107.5 bits (267), Expect = 9.3e-21 Identity = 55/66 (83.33%), Postives = 56/66 (84.85%), Query Frame = 1
BLAST of MELO3C026942 vs. NCBI nr
Match: gi|525507300|ref|NP_001267690.1| (3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis sativus]) HSP 1 Score: 90.9 bits (224), Expect = 9.0e-16 Identity = 49/66 (74.24%), Postives = 51/66 (77.27%), Query Frame = 1
BLAST of MELO3C026942 vs. NCBI nr
Match: gi|297843282|ref|XP_002889522.1| (hypothetical protein ARALYDRAFT_470458 [Arabidopsis lyrata subsp. lyrata]) HSP 1 Score: 89.7 bits (221), Expect = 2.0e-15 Identity = 47/66 (71.21%), Postives = 51/66 (77.27%), Query Frame = 1
BLAST of MELO3C026942 vs. NCBI nr
Match: gi|7433647|pir||S72532 (acetyl-CoA C-acyltransferase (EC 2.3.1.16) precursor - cucurbit) HSP 1 Score: 89.4 bits (220), Expect = 2.6e-15 Identity = 48/66 (72.73%), Postives = 50/66 (75.76%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|