MELO3C026801 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCATGGCAAAAGCAATCCTCGTTTTCTTTTTCTTACCCCACCATCCTGTACTAGTAAGTGTCAAGCAAGAAGGAAGTACATTGAGATACCTCCCAATCAGACGAAGAAAGGCTTTACCGATAGAAGAGGCGGTGGCGGTCCTAAGAAGAAGCCTGTCTCTCGCTCTATTAAAATCGACCTCCAGTTTCCTGTCGGCGGAATCGGCTGCTACTTGAAGAATGGTTGTTACTCTCAACGAGTCAGAATCGGCGCTCTGGTTTACCTTGCTATTGTGCTTGAGTGCCTCCCTGCTGAGGTGAATCTATAA ATGCATGGCAAAAGCAATCCTCGTTTTCTTTTTCTTACCCCACCATCCTGTACTAGTAAGTGTCAAGCAAGAAGGAAGTACATTGAGATACCTCCCAATCAGACGAAGAAAGGCTTTACCGATAGAAGAGGCGGTGGCGGTCCTAAGAAGAAGCCTGTCTCTCGCTCTATTAAAATCGACCTCCAGTTTCCTGTCGGCGGAATCGGCTGCTACTTGAAGAATGGTTGTTACTCTCAACGAGTCAGAATCGGCGCTCTGGTTTACCTTGCTATTGTGCTTGAGTGCCTCCCTGCTGAGGTGAATCTATAA ATGCATGGCAAAAGCAATCCTCGTTTTCTTTTTCTTACCCCACCATCCTGTACTAGTAAGTGTCAAGCAAGAAGGAAGTACATTGAGATACCTCCCAATCAGACGAAGAAAGGCTTTACCGATAGAAGAGGCGGTGGCGGTCCTAAGAAGAAGCCTGTCTCTCGCTCTATTAAAATCGACCTCCAGTTTCCTGTCGGCGGAATCGGCTGCTACTTGAAGAATGGTTGTTACTCTCAACGAGTCAGAATCGGCGCTCTGGTTTACCTTGCTATTGTGCTTGAGTGCCTCCCTGCTGAGGTGAATCTATAA MHGKSNPRFLFLTPPSCTSKCQARRKYIEIPPNQTKKGFTDRRGGGGPKKKPVSRSIKIDLQFPVGGIGCYLKNGCYSQRVRIGALVYLAIVLECLPAEVNL*
BLAST of MELO3C026801 vs. Swiss-Prot
Match: H2A4_ORYSJ (Probable histone H2A.4 OS=Oryza sativa subsp. japonica GN=Os05g0461400 PE=2 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 2.6e-17 Identity = 47/65 (72.31%), Postives = 47/65 (72.31%), Query Frame = 1
BLAST of MELO3C026801 vs. Swiss-Prot
Match: H2A4_ORYSI (Probable histone H2A.4 OS=Oryza sativa subsp. indica GN=OsI_019561 PE=3 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 2.6e-17 Identity = 47/65 (72.31%), Postives = 47/65 (72.31%), Query Frame = 1
BLAST of MELO3C026801 vs. Swiss-Prot
Match: H2A4_ARATH (Probable histone H2A.4 OS=Arabidopsis thaliana GN=At5g02560 PE=1 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 3.4e-17 Identity = 47/67 (70.15%), Postives = 48/67 (71.64%), Query Frame = 1
BLAST of MELO3C026801 vs. Swiss-Prot
Match: H2A_EUPES (Histone H2A OS=Euphorbia esula PE=2 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 4.1e-15 Identity = 45/65 (69.23%), Postives = 48/65 (73.85%), Query Frame = 1
BLAST of MELO3C026801 vs. Swiss-Prot
Match: H2A2_MEDTR (Probable histone H2A.2 OS=Medicago truncatula GN=MtrDRAFT_AC149210g4v1 PE=3 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 3.5e-14 Identity = 44/67 (65.67%), Postives = 48/67 (71.64%), Query Frame = 1
BLAST of MELO3C026801 vs. TrEMBL
Match: K3ZAC4_SETIT (Histone H2A OS=Setaria italica GN=SETIT_023495mg PE=3 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 3.4e-16 Identity = 48/65 (73.85%), Postives = 50/65 (76.92%), Query Frame = 1
BLAST of MELO3C026801 vs. TrEMBL
Match: A0A0A0KXF2_CUCSA (Histone H2A OS=Cucumis sativus GN=Csa_4G293870 PE=3 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.3e-15 Identity = 48/67 (71.64%), Postives = 50/67 (74.63%), Query Frame = 1
BLAST of MELO3C026801 vs. TrEMBL
Match: A0A0D9WHD2_9ORYZ (Histone H2A OS=Leersia perrieri PE=3 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 2.9e-15 Identity = 47/65 (72.31%), Postives = 49/65 (75.38%), Query Frame = 1
BLAST of MELO3C026801 vs. TrEMBL
Match: B4FJK0_MAIZE (Histone H2A OS=Zea mays GN=gpm729 PE=2 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 2.9e-15 Identity = 47/65 (72.31%), Postives = 49/65 (75.38%), Query Frame = 1
BLAST of MELO3C026801 vs. TrEMBL
Match: B6TMR1_MAIZE (Histone H2A OS=Zea mays PE=2 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 2.9e-15 Identity = 47/65 (72.31%), Postives = 49/65 (75.38%), Query Frame = 1
BLAST of MELO3C026801 vs. TAIR10
Match: AT5G02560.2 (AT5G02560.2 histone H2A 12) HSP 1 Score: 87.4 bits (215), Expect = 5.5e-18 Identity = 46/66 (69.70%), Postives = 47/66 (71.21%), Query Frame = 1
BLAST of MELO3C026801 vs. TAIR10
Match: AT5G59870.1 (AT5G59870.1 histone H2A 6) HSP 1 Score: 67.4 bits (163), Expect = 5.9e-12 Identity = 37/67 (55.22%), Postives = 43/67 (64.18%), Query Frame = 1
BLAST of MELO3C026801 vs. TAIR10
Match: AT5G27670.1 (AT5G27670.1 histone H2A 7) HSP 1 Score: 62.4 bits (150), Expect = 1.9e-10 Identity = 34/55 (61.82%), Postives = 36/55 (65.45%), Query Frame = 1
BLAST of MELO3C026801 vs. TAIR10
Match: AT3G20670.1 (AT3G20670.1 histone H2A 13) HSP 1 Score: 62.0 bits (149), Expect = 2.5e-10 Identity = 35/56 (62.50%), Postives = 35/56 (62.50%), Query Frame = 1
BLAST of MELO3C026801 vs. TAIR10
Match: AT4G27230.1 (AT4G27230.1 histone H2A 2) HSP 1 Score: 60.5 bits (145), Expect = 7.2e-10 Identity = 34/56 (60.71%), Postives = 35/56 (62.50%), Query Frame = 1
BLAST of MELO3C026801 vs. NCBI nr
Match: gi|659130580|ref|XP_008465242.1| (PREDICTED: histone H2A-like [Cucumis melo]) HSP 1 Score: 210.3 bits (534), Expect = 1.6e-51 Identity = 99/99 (100.00%), Postives = 99/99 (100.00%), Query Frame = 1
BLAST of MELO3C026801 vs. NCBI nr
Match: gi|659068988|ref|XP_008447608.1| (PREDICTED: probable histone H2A.4 [Cucumis melo]) HSP 1 Score: 96.3 bits (238), Expect = 3.4e-17 Identity = 50/67 (74.63%), Postives = 52/67 (77.61%), Query Frame = 1
BLAST of MELO3C026801 vs. NCBI nr
Match: gi|514749347|ref|XP_004961835.1| (PREDICTED: probable histone H2A.4 [Setaria italica]) HSP 1 Score: 92.4 bits (228), Expect = 4.8e-16 Identity = 48/65 (73.85%), Postives = 50/65 (76.92%), Query Frame = 1
BLAST of MELO3C026801 vs. NCBI nr
Match: gi|449448657|ref|XP_004142082.1| (PREDICTED: probable histone H2A.4 [Cucumis sativus]) HSP 1 Score: 90.5 bits (223), Expect = 1.8e-15 Identity = 48/67 (71.64%), Postives = 50/67 (74.63%), Query Frame = 1
BLAST of MELO3C026801 vs. NCBI nr
Match: gi|1012032138|ref|XP_015952280.1| (PREDICTED: histone H2A-like [Arachis duranensis]) HSP 1 Score: 89.7 bits (221), Expect = 3.1e-15 Identity = 49/73 (67.12%), Postives = 54/73 (73.97%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|