MELO3C026793 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGACAATCAATATGACAATCAACTTCATTGAACAAATTGTAGACATACCTGGATGCCTGTATACTGTTAATCCAATTGCTGTCAATAGCAAGTATTGCAATGTCTTCACAGAGAACAAGCGTTCAGTAGCAATGGCACAACTCAATCAAGAGTTGAT ATGGAGACAATCAATATGACAATCAACTTCATTGAACAAATTGTAGACATACCTGGATGCCTGTATACTGTTAATCCAATTGCTGTCAATAGCAAGTATTGCAATGTCTTCACAGAGAACAAGCGTTCAGTAGCAATGGCACAACTCAATCAAGAGTTGAT ATGGAGACAATCAATATGACAATCAACTTCATTGAACAAATTGTAGACATACCTGGATGCCTGTATACTGTTAATCCAATTGCTGTCAATAGCAAGTATTGCAATGTCTTCACAGAGAACAAGCGTTCAGTAGCAATGGCACAACTCAATCAAGAGTTGAT METINMTINFIEQIVDIPGCLYTVNPIAVNSKYCNVFTENKRSVAMAQLNQEL
BLAST of MELO3C026793 vs. Swiss-Prot
Match: PSD2_ORYSJ (Phosphatidylserine decarboxylase proenzyme 2 OS=Oryza sativa subsp. japonica GN=PSD2 PE=3 SV=3) HSP 1 Score: 67.4 bits (163), Expect = 5.4e-11 Identity = 29/41 (70.73%), Postives = 34/41 (82.93%), Query Frame = 1
BLAST of MELO3C026793 vs. Swiss-Prot
Match: PSD2_ARATH (Phosphatidylserine decarboxylase proenzyme 2 OS=Arabidopsis thaliana GN=PSD2 PE=2 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 1.6e-10 Identity = 30/36 (83.33%), Postives = 31/36 (86.11%), Query Frame = 1
BLAST of MELO3C026793 vs. Swiss-Prot
Match: PSD3_ARATH (Phosphatidylserine decarboxylase proenzyme 3 OS=Arabidopsis thaliana GN=PSD3 PE=1 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 6.6e-09 Identity = 26/36 (72.22%), Postives = 30/36 (83.33%), Query Frame = 1
BLAST of MELO3C026793 vs. TrEMBL
Match: A0A103YKT5_CYNCS (C2 calcium/lipid-binding domain, CaLB OS=Cynara cardunculus var. scolymus GN=Ccrd_010631 PE=4 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 8.4e-11 Identity = 33/36 (91.67%), Postives = 36/36 (100.00%), Query Frame = 1
BLAST of MELO3C026793 vs. TrEMBL
Match: S8D2H7_9LAMI (Phosphatidylserine decarboxylase OS=Genlisea aurea GN=M569_01147 PE=4 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 2.4e-10 Identity = 32/36 (88.89%), Postives = 34/36 (94.44%), Query Frame = 1
BLAST of MELO3C026793 vs. TrEMBL
Match: A0A103Y3F5_CYNCS (C2 calcium-dependent membrane targeting OS=Cynara cardunculus var. scolymus GN=Ccrd_019909 PE=4 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 3.2e-10 Identity = 32/36 (88.89%), Postives = 36/36 (100.00%), Query Frame = 1
BLAST of MELO3C026793 vs. TrEMBL
Match: I3SXC8_LOTJA (Uncharacterized protein OS=Lotus japonicus PE=2 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 5.4e-10 Identity = 32/36 (88.89%), Postives = 34/36 (94.44%), Query Frame = 1
BLAST of MELO3C026793 vs. TrEMBL
Match: I3T798_LOTJA (Uncharacterized protein OS=Lotus japonicus PE=2 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 5.4e-10 Identity = 32/36 (88.89%), Postives = 34/36 (94.44%), Query Frame = 1
BLAST of MELO3C026793 vs. TAIR10
Match: AT5G57190.1 (AT5G57190.1 phosphatidylserine decarboxylase 2) HSP 1 Score: 65.9 bits (159), Expect = 8.8e-12 Identity = 30/36 (83.33%), Postives = 31/36 (86.11%), Query Frame = 1
BLAST of MELO3C026793 vs. TAIR10
Match: AT4G25970.1 (AT4G25970.1 phosphatidylserine decarboxylase 3) HSP 1 Score: 60.5 bits (145), Expect = 3.7e-10 Identity = 26/36 (72.22%), Postives = 30/36 (83.33%), Query Frame = 1
BLAST of MELO3C026793 vs. NCBI nr
Match: gi|778724254|ref|XP_011658767.1| (PREDICTED: phosphatidylserine decarboxylase proenzyme 2 [Cucumis sativus]) HSP 1 Score: 78.2 bits (191), Expect = 4.9e-12 Identity = 36/37 (97.30%), Postives = 37/37 (100.00%), Query Frame = 1
BLAST of MELO3C026793 vs. NCBI nr
Match: gi|659110477|ref|XP_008455245.1| (PREDICTED: phosphatidylserine decarboxylase proenzyme 3-like [Cucumis melo]) HSP 1 Score: 78.2 bits (191), Expect = 4.9e-12 Identity = 36/37 (97.30%), Postives = 37/37 (100.00%), Query Frame = 1
BLAST of MELO3C026793 vs. NCBI nr
Match: gi|976927159|gb|KVI10971.1| (C2 calcium/lipid-binding domain, CaLB [Cynara cardunculus var. scolymus]) HSP 1 Score: 73.6 bits (179), Expect = 1.2e-10 Identity = 33/36 (91.67%), Postives = 36/36 (100.00%), Query Frame = 1
BLAST of MELO3C026793 vs. NCBI nr
Match: gi|527208679|gb|EPS73610.1| (phosphatidylserine decarboxylase [Genlisea aurea]) HSP 1 Score: 72.0 bits (175), Expect = 3.5e-10 Identity = 32/36 (88.89%), Postives = 34/36 (94.44%), Query Frame = 1
BLAST of MELO3C026793 vs. NCBI nr
Match: gi|729331678|ref|XP_010536896.1| (PREDICTED: LOW QUALITY PROTEIN: phosphatidylserine decarboxylase proenzyme 3-like [Tarenaya hassleriana]) HSP 1 Score: 71.6 bits (174), Expect = 4.6e-10 Identity = 32/36 (88.89%), Postives = 35/36 (97.22%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|