MELO3C026655.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCACAATTAGTTCAAATTCTTGCAAAAGGGAATGCTTTGGAATATTCCATTCTTGTAGTCGCCACCGCTTCGGATCCTGCGCCTCAATTTATGGCCTCATATTCTTCATGTGTCATGGGGGAATACTTCCACAATAATGGAATGCACACATTAATAATCTATGATGATGTTAGTAAACAG ATGGCACAATTAGTTCAAATTCTTGCAAAAGGGAATGCTTTGGAATATTCCATTCTTGTAGTCGCCACCGCTTCGGATCCTGCGCCTCAATTTATGGCCTCATATTCTTCATGTGTCATGGGGGAATACTTCCACAATAATGGAATGCACACATTAATAATCTATGATGATGTTAGTAAACAG ATGGCACAATTAGTTCAAATTCTTGCAAAAGGGAATGCTTTGGAATATTCCATTCTTGTAGTCGCCACCGCTTCGGATCCTGCGCCTCAATTTATGGCCTCATATTCTTCATGTGTCATGGGGGAATACTTCCACAATAATGGAATGCACACATTAATAATCTATGATGATGTTAGTAAACAG MAQLVQILAKGNALEYSILVVATASDPAPQFMASYSSCVMGEYFHNNGMHTLIIYDDVSKQ
BLAST of MELO3C026655.2 vs. NCBI nr
Match: AEN56129.1 (ATPase subunit 1 (mitochondrion) [Cucumis melo subsp. melo]) HSP 1 Score: 99.0 bits (245), Expect = 6.0e-18 Identity = 50/62 (80.65%), Postives = 55/62 (88.71%), Query Frame = 0
BLAST of MELO3C026655.2 vs. NCBI nr
Match: PRQ15600.1 (putative H(+)-transporting two-sector ATPase (mitochondrion) [Rosa chinensis]) HSP 1 Score: 98.2 bits (243), Expect = 1.0e-17 Identity = 49/62 (79.03%), Postives = 55/62 (88.71%), Query Frame = 0
BLAST of MELO3C026655.2 vs. NCBI nr
Match: AAF16978.1 (ATPase alpha subunit, partial (mitochondrion) [Cocculus trilobus]) HSP 1 Score: 97.8 bits (242), Expect = 1.3e-17 Identity = 49/62 (79.03%), Postives = 55/62 (88.71%), Query Frame = 0
BLAST of MELO3C026655.2 vs. NCBI nr
Match: AAF16977.1 (ATPase alpha subunit, partial (mitochondrion) [Cissampelos pareira]) HSP 1 Score: 97.8 bits (242), Expect = 1.3e-17 Identity = 49/62 (79.03%), Postives = 55/62 (88.71%), Query Frame = 0
BLAST of MELO3C026655.2 vs. NCBI nr
Match: AAV66507.1 (F1-ATPase alpha subunit, partial (mitochondrion) [Plantago rigida]) HSP 1 Score: 97.8 bits (242), Expect = 1.3e-17 Identity = 49/62 (79.03%), Postives = 55/62 (88.71%), Query Frame = 0
BLAST of MELO3C026655.2 vs. TAIR10
Match: AT2G07698.1 (ATPase, F1 complex, alpha subunit protein) HSP 1 Score: 90.9 bits (224), Expect = 2.9e-19 Identity = 45/62 (72.58%), Postives = 51/62 (82.26%), Query Frame = 0
BLAST of MELO3C026655.2 vs. TAIR10
Match: ATMG01190.1 (ATP synthase subunit 1) HSP 1 Score: 90.9 bits (224), Expect = 2.9e-19 Identity = 45/62 (72.58%), Postives = 51/62 (82.26%), Query Frame = 0
BLAST of MELO3C026655.2 vs. TAIR10
Match: ATCG00120.1 (ATP synthase subunit alpha) HSP 1 Score: 57.4 bits (137), Expect = 3.6e-09 Identity = 30/62 (48.39%), Postives = 41/62 (66.13%), Query Frame = 0
BLAST of MELO3C026655.2 vs. Swiss-Prot
Match: sp|P05492|ATPAM_OENBI (ATP synthase subunit alpha, mitochondrial OS=Oenothera biennis OX=3942 GN=ATPA PE=3 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 4.3e-20 Identity = 49/62 (79.03%), Postives = 55/62 (88.71%), Query Frame = 0
BLAST of MELO3C026655.2 vs. Swiss-Prot
Match: sp|Q06735|ATPAM_BETVU (ATP synthase subunit alpha, mitochondrial OS=Beta vulgaris OX=161934 GN=ATPA PE=3 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 2.2e-19 Identity = 48/62 (77.42%), Postives = 54/62 (87.10%), Query Frame = 0
BLAST of MELO3C026655.2 vs. Swiss-Prot
Match: sp|P05495|ATPAM_NICPL (ATP synthase subunit alpha, mitochondrial OS=Nicotiana plumbaginifolia OX=4092 GN=ATPA PE=3 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 2.2e-19 Identity = 48/62 (77.42%), Postives = 54/62 (87.10%), Query Frame = 0
BLAST of MELO3C026655.2 vs. Swiss-Prot
Match: sp|P0C520|ATPAM_ORYSA (ATP synthase subunit alpha, mitochondrial OS=Oryza sativa OX=4530 GN=ATPA PE=3 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 2.2e-19 Identity = 48/62 (77.42%), Postives = 54/62 (87.10%), Query Frame = 0
BLAST of MELO3C026655.2 vs. Swiss-Prot
Match: sp|P0C521|ATPAM_ORYSI (ATP synthase subunit alpha, mitochondrial OS=Oryza sativa subsp. indica OX=39946 GN=ATPA PE=3 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 2.2e-19 Identity = 48/62 (77.42%), Postives = 54/62 (87.10%), Query Frame = 0
BLAST of MELO3C026655.2 vs. TrEMBL
Match: tr|G3EU05|G3EU05_CUCME (ATP synthase subunit alpha OS=Cucumis melo subsp. melo OX=412675 GN=atp1 PE=3 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 3.9e-18 Identity = 50/62 (80.65%), Postives = 55/62 (88.71%), Query Frame = 0
BLAST of MELO3C026655.2 vs. TrEMBL
Match: tr|A0A2P6P0Y8|A0A2P6P0Y8_ROSCH (ATP synthase subunit alpha OS=Rosa chinensis OX=74649 GN=RchiOBHm_MTg0498251 PE=3 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 6.7e-18 Identity = 49/62 (79.03%), Postives = 55/62 (88.71%), Query Frame = 0
BLAST of MELO3C026655.2 vs. TrEMBL
Match: tr|D0QLF3|D0QLF3_9CARY (ATP synthase subunit alpha (Fragment) OS=Silene gallinyi OX=663347 GN=atp1 PE=4 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 8.8e-18 Identity = 49/62 (79.03%), Postives = 55/62 (88.71%), Query Frame = 0
BLAST of MELO3C026655.2 vs. TrEMBL
Match: tr|Q7M2G6|Q7M2G6_OENVI (ATP synthase subunit alpha OS=Oenothera villaricae OX=3941 PE=3 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 8.8e-18 Identity = 49/62 (79.03%), Postives = 55/62 (88.71%), Query Frame = 0
BLAST of MELO3C026655.2 vs. TrEMBL
Match: tr|E5DKD4|E5DKD4_MORLO (ATP synthase subunit alpha (Fragment) OS=Morina longifolia OX=180562 GN=atp1 PE=4 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 8.8e-18 Identity = 49/62 (79.03%), Postives = 55/62 (88.71%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|