MELO3C026355 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATTAGTAGATTGTGTATCATGTATATACGTTTTCAAATTCATAACTATTTAATAAAAAAGAATGTTGATTAGATCAAAATTGAAAGTCACCAATAATTTTCGTTTATCATGGGTAAGGACACTATTACTAACATAATAACCTCTATTCGTAATGCTGACATGAATAGAAAAGGAATGGTTCAAATACCATCTACTAACATCACCGAAAACATTGTGAAAAGACTTTTACGAGAAGGTTTTATTGAAAACTTAAGGAAACATTGGGAAAACAACAAGGATTTTTAGGTTTGAACCCTACAACATAGAAGAAATAGGAAAGGA ATTAGTAGATTGTGTATCATGTATATACGTTTTCAAATTCATAACTATTTAATAAAAAAGAATGTTGATTAGATCAAAATTGAAAGTCACCAATAATTTTCGTTTATCATGGGTAAGGACACTATTACTAACATAATAACCTCTATTCGTAATGCTGACATGAATAGAAAAGGAATGGTTCAAATACCATCTACTAACATCACCGAAAACATTGTGAAAAGACTTTTACGAGAAGGTTTTATTGAAAACTTAAGGAAACATTGGGAAAACAACAAGGATTTTTAGGTTTGAACCCTACAACATAGAAGAAATAGGAAAGGA ATGGGTAAGGACACTATTACTAACATAATAACCTCTATTCGTAATGCTGACATGAATAGAAAAGGAATGGTTCAAATACCATCTACTAACATCACCGAAAACATTGTGAAAAGACTTTTACGAGAAGGTTTTATTGAAAACTTAAGGAAACATTGGGAAAACAACAAGGATTTTTAG MGKDTITNIITSIRNADMNRKGMVQIPSTNITENIVKRLLREGFIENLRKHWENNKDF*
BLAST of MELO3C026355 vs. Swiss-Prot
Match: RR8_CUCSA (30S ribosomal protein S8, chloroplastic OS=Cucumis sativus GN=rps8 PE=3 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 4.4e-22 Identity = 51/58 (87.93%), Postives = 54/58 (93.10%), Query Frame = 1
BLAST of MELO3C026355 vs. Swiss-Prot
Match: RR8_PHAAN (30S ribosomal protein S8, chloroplastic OS=Phaseolus angularis GN=rps8 PE=3 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 9.2e-20 Identity = 47/58 (81.03%), Postives = 49/58 (84.48%), Query Frame = 1
BLAST of MELO3C026355 vs. Swiss-Prot
Match: RR8_NYMAL (30S ribosomal protein S8, chloroplastic OS=Nymphaea alba GN=rps8 PE=3 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 9.2e-20 Identity = 47/58 (81.03%), Postives = 51/58 (87.93%), Query Frame = 1
BLAST of MELO3C026355 vs. Swiss-Prot
Match: RR8_EUCGG (30S ribosomal protein S8, chloroplastic OS=Eucalyptus globulus subsp. globulus GN=rps8 PE=3 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 2.1e-19 Identity = 47/58 (81.03%), Postives = 51/58 (87.93%), Query Frame = 1
BLAST of MELO3C026355 vs. Swiss-Prot
Match: RR8_SOYBN (30S ribosomal protein S8, chloroplastic OS=Glycine max GN=rps8 PE=3 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 2.1e-19 Identity = 47/58 (81.03%), Postives = 50/58 (86.21%), Query Frame = 1
BLAST of MELO3C026355 vs. TrEMBL
Match: A0A109WXX2_GYNPE (30S ribosomal protein S8, chloroplastic OS=Gynostemma pentaphyllum GN=rps8 PE=3 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 4.5e-21 Identity = 53/58 (91.38%), Postives = 55/58 (94.83%), Query Frame = 1
BLAST of MELO3C026355 vs. TrEMBL
Match: G3ETT3_CUCME (30S ribosomal protein S8, chloroplastic OS=Cucumis melo subsp. melo GN=rps8 PE=3 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 2.2e-20 Identity = 52/58 (89.66%), Postives = 55/58 (94.83%), Query Frame = 1
BLAST of MELO3C026355 vs. TrEMBL
Match: X2F8R8_LAGSI (30S ribosomal protein S8, chloroplastic OS=Lagenaria siceraria GN=rps8 PE=3 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 2.2e-20 Identity = 52/58 (89.66%), Postives = 55/58 (94.83%), Query Frame = 1
BLAST of MELO3C026355 vs. TrEMBL
Match: X2F824_LAGSI (30S ribosomal protein S8, chloroplastic OS=Lagenaria siceraria GN=rps8 PE=3 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 2.2e-20 Identity = 52/58 (89.66%), Postives = 55/58 (94.83%), Query Frame = 1
BLAST of MELO3C026355 vs. TrEMBL
Match: X2F6H3_LAGSI (30S ribosomal protein S8, chloroplastic OS=Lagenaria siceraria GN=rps8 PE=3 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 2.2e-20 Identity = 52/58 (89.66%), Postives = 55/58 (94.83%), Query Frame = 1
BLAST of MELO3C026355 vs. TAIR10
Match: ATCG00770.1 (ATCG00770.1 ribosomal protein S8) HSP 1 Score: 92.8 bits (229), Expect = 7.5e-20 Identity = 47/58 (81.03%), Postives = 51/58 (87.93%), Query Frame = 1
BLAST of MELO3C026355 vs. NCBI nr
Match: gi|1002166200|ref|YP_009236314.1| (ribosomal protein S8 (chloroplast) [Gynostemma pentaphyllum]) HSP 1 Score: 107.8 bits (268), Expect = 6.4e-21 Identity = 53/58 (91.38%), Postives = 55/58 (94.83%), Query Frame = 1
BLAST of MELO3C026355 vs. NCBI nr
Match: gi|595645250|gb|AHM88713.1| (ribosomal protein S8 (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 105.5 bits (262), Expect = 3.2e-20 Identity = 52/58 (89.66%), Postives = 55/58 (94.83%), Query Frame = 1
BLAST of MELO3C026355 vs. NCBI nr
Match: gi|346578227|ref|YP_004841819.1| (ribosomal protein S8 [Cucumis melo subsp. melo]) HSP 1 Score: 105.5 bits (262), Expect = 3.2e-20 Identity = 52/58 (89.66%), Postives = 55/58 (94.83%), Query Frame = 1
BLAST of MELO3C026355 vs. NCBI nr
Match: gi|595647826|gb|AHM91246.1| (ribosomal protein S8 (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 105.5 bits (262), Expect = 3.2e-20 Identity = 52/58 (89.66%), Postives = 55/58 (94.83%), Query Frame = 1
BLAST of MELO3C026355 vs. NCBI nr
Match: gi|595647587|gb|AHM91011.1| (ribosomal protein S8 (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 105.5 bits (262), Expect = 3.2e-20 Identity = 52/58 (89.66%), Postives = 55/58 (94.83%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|