MELO3C026301.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.AAGTATAGGCGTGCTAGGCTGCCTGCCAATCTTGTGAAGGCTCAAAGAGACTTATTTGAGGCTCATACATATGAGCGGGTGGATCGCCTAGACTCCTACCACACGGGGTGGACAAAGCTGGCTCGCAATGCTAATACTGGAGTTGGCATTTTCAACTTAGCTTTTGAGCTGCCTACCAATTTGGTTGGTTTTCTTTCTCTGCTTTGATTGGGTGCAAATGTCCTACTTGATTTTGCTTGCCCATTTCAAAAGTTGGTAAGTTTTCCTTTTTATATCACAATTTGGACAGTCTTCCATGCTTCTTAGGGGAGTAGATAG AAGTATAGGCGTGCTAGGCTGCCTGCCAATCTTGTGAAGGCTCAAAGAGACTTATTTGAGGCTCATACATATGAGCGGGTGGATCGCCTAGACTCCTACCACACGGGGTGGACAAAGCTGGCTCGCAATGCTAATACTGGAGTTGGCATTTTCAACTTAGCTTTTGAGCTGCCTACCAATTTGGTTGGTTTTCTTTCTCTGCTTTGATTGGGTGCAAATGTCCTACTTGATTTTGCTTGCCCATTTCAAAAGTTGGTAAGTTTTCCTTTTTATATCACAATTTGGACAGTCTTCCATGCTTCTTAGGGGAGTAGATAG AAGTATAGGCGTGCTAGGCTGCCTGCCAATCTTGTGAAGGCTCAAAGAGACTTATTTGAGGCTCATACATATGAGCGGGTGGATCGCCTAGACTCCTACCACACGGGGTGGACAAAGCTGGCTCGCAATGCTAATACTGGAGTTGGCATTTTCAACTTAGCTTTTGAGCTGCCTACCAATTTGGTTGGTTTTCTTTCTCTGCTTTGA KYRRARLPANLVKAQRDLFEAHTYERVDRLDSYHTGWTKLARNANTGVGIFNLAFELPTNLVGFLSLL
BLAST of MELO3C026301.2 vs. NCBI nr
Match: XP_008451978.1 (PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 2, chloroplastic [Cucumis melo]) HSP 1 Score: 92.8 bits (229), Expect = 4.8e-16 Identity = 44/51 (86.27%), Postives = 46/51 (90.20%), Query Frame = 0
BLAST of MELO3C026301.2 vs. NCBI nr
Match: XP_011653205.1 (PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 2, chloroplastic [Cucumis sativus] >KGN53379.1 6-phosphogluconate dehydrogenase, decarboxylating [Cucumis sativus]) HSP 1 Score: 90.9 bits (224), Expect = 1.8e-15 Identity = 43/51 (84.31%), Postives = 46/51 (90.20%), Query Frame = 0
BLAST of MELO3C026301.2 vs. NCBI nr
Match: ACF20291.1 (6-phosphogluconate dehydrogenase, partial [Cucumis sativus]) HSP 1 Score: 90.9 bits (224), Expect = 1.8e-15 Identity = 43/51 (84.31%), Postives = 46/51 (90.20%), Query Frame = 0
BLAST of MELO3C026301.2 vs. NCBI nr
Match: NP_001295849.1 (6-phosphogluconate dehydrogenase, decarboxylating 2, chloroplastic [Cucumis sativus] >ACM68927.1 6-phosphogluconate dehydrogenase [Cucumis sativus]) HSP 1 Score: 90.9 bits (224), Expect = 1.8e-15 Identity = 43/51 (84.31%), Postives = 46/51 (90.20%), Query Frame = 0
BLAST of MELO3C026301.2 vs. NCBI nr
Match: XP_021669703.1 (6-phosphogluconate dehydrogenase, decarboxylating 2, chloroplastic-like [Hevea brasiliensis]) HSP 1 Score: 87.8 bits (216), Expect = 1.5e-14 Identity = 41/51 (80.39%), Postives = 45/51 (88.24%), Query Frame = 0
BLAST of MELO3C026301.2 vs. TAIR10
Match: AT5G41670.1 (6-phosphogluconate dehydrogenase family protein) HSP 1 Score: 73.6 bits (179), Expect = 5.4e-14 Identity = 34/43 (79.07%), Postives = 37/43 (86.05%), Query Frame = 0
BLAST of MELO3C026301.2 vs. TAIR10
Match: AT1G64190.1 (6-phosphogluconate dehydrogenase family protein) HSP 1 Score: 73.2 bits (178), Expect = 7.1e-14 Identity = 34/41 (82.93%), Postives = 36/41 (87.80%), Query Frame = 0
BLAST of MELO3C026301.2 vs. TAIR10
Match: AT3G02360.2 (6-phosphogluconate dehydrogenase family protein) HSP 1 Score: 62.8 bits (151), Expect = 9.6e-11 Identity = 29/43 (67.44%), Postives = 33/43 (76.74%), Query Frame = 0
BLAST of MELO3C026301.2 vs. Swiss-Prot
Match: sp|Q9FFR3|6PGD2_ARATH (6-phosphogluconate dehydrogenase, decarboxylating 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g41670 PE=1 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 9.8e-13 Identity = 34/43 (79.07%), Postives = 37/43 (86.05%), Query Frame = 0
BLAST of MELO3C026301.2 vs. Swiss-Prot
Match: sp|Q9SH69|6PGD1_ARATH (6-phosphogluconate dehydrogenase, decarboxylating 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g64190 PE=1 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.3e-12 Identity = 34/41 (82.93%), Postives = 36/41 (87.80%), Query Frame = 0
BLAST of MELO3C026301.2 vs. Swiss-Prot
Match: sp|Q2R480|6PGD2_ORYSJ (6-phosphogluconate dehydrogenase, decarboxylating 2, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=G6PGH2 PE=2 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 2.8e-12 Identity = 32/44 (72.73%), Postives = 38/44 (86.36%), Query Frame = 0
BLAST of MELO3C026301.2 vs. Swiss-Prot
Match: sp|Q94KU2|6PGD2_SPIOL (6-phosphogluconate dehydrogenase, decarboxylating 2, chloroplastic OS=Spinacia oleracea OX=3562 GN=pgdP PE=1 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 3.7e-12 Identity = 34/47 (72.34%), Postives = 38/47 (80.85%), Query Frame = 0
BLAST of MELO3C026301.2 vs. Swiss-Prot
Match: sp|Q9LI00|6PGD1_ORYSJ (6-phosphogluconate dehydrogenase, decarboxylating 1 OS=Oryza sativa subsp. japonica OX=39947 GN=G6PGH1 PE=2 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 3.5e-10 Identity = 31/43 (72.09%), Postives = 34/43 (79.07%), Query Frame = 0
BLAST of MELO3C026301.2 vs. TrEMBL
Match: tr|A0A1S3BST6|A0A1S3BST6_CUCME (6-phosphogluconate dehydrogenase, decarboxylating OS=Cucumis melo OX=3656 GN=LOC103493120 PE=3 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 3.2e-16 Identity = 44/51 (86.27%), Postives = 46/51 (90.20%), Query Frame = 0
BLAST of MELO3C026301.2 vs. TrEMBL
Match: tr|B3VTV3|B3VTV3_CUCSA (6-phosphogluconate dehydrogenase (Fragment) OS=Cucumis sativus OX=3659 PE=2 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 1.2e-15 Identity = 43/51 (84.31%), Postives = 46/51 (90.20%), Query Frame = 0
BLAST of MELO3C026301.2 vs. TrEMBL
Match: tr|B9VWD5|B9VWD5_CUCSA (6-phosphogluconate dehydrogenase, decarboxylating OS=Cucumis sativus OX=3659 GN=6PGDH PE=2 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 1.2e-15 Identity = 43/51 (84.31%), Postives = 46/51 (90.20%), Query Frame = 0
BLAST of MELO3C026301.2 vs. TrEMBL
Match: tr|A0A0A0KWX8|A0A0A0KWX8_CUCSA (6-phosphogluconate dehydrogenase, decarboxylating OS=Cucumis sativus OX=3659 GN=Csa_4G050830 PE=3 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 1.2e-15 Identity = 43/51 (84.31%), Postives = 46/51 (90.20%), Query Frame = 0
BLAST of MELO3C026301.2 vs. TrEMBL
Match: tr|B9RVA7|B9RVA7_RICCO (6-phosphogluconate dehydrogenase, decarboxylating OS=Ricinus communis OX=3988 GN=RCOM_0901440 PE=3 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 1.7e-14 Identity = 40/51 (78.43%), Postives = 44/51 (86.27%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |