MELO3C026294.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGGTGTTTAAGAAGTTCGAGTTGGAATTAACAACATGCCAAATCCTTGACGTGTCGACATCAGAACCTGCGATTAATATTGCAACTGGTGAAACAGTGGCTACAGTTTGTGACGATTCATCAAGCTCTGCGTTATCAAATCTAAAGCTAGCTGAAGAAGCTGAAAAAGAGAATGCAAACTAG ATGGAGGTGTTTAAGAAGTTCGAGTTGGAATTAACAACATGCCAAATCCTTGACGTGTCGACATCAGAACCTGCGATTAATATTGCAACTGGTGAAACAGTGGCTACAGTTTGTGACGATTCATCAAGCTCTGCGTTATCAAATCTAAAGCTAGCTGAAGAAGCTGAAAAAGAGAATGCAAACTAG ATGGAGGTGTTTAAGAAGTTCGAGTTGGAATTAACAACATGCCAAATCCTTGACGTGTCGACATCAGAACCTGCGATTAATATTGCAACTGGTGAAACAGTGGCTACAGTTTGTGACGATTCATCAAGCTCTGCGTTATCAAATCTAAAGCTAGCTGAAGAAGCTGAAAAAGAGAATGCAAACTAG MEVFKKFELELTTCQILDVSTSEPAINIATGETVATVCDDSSSSALSNLKLAEEAEKENAN
BLAST of MELO3C026294.2 vs. NCBI nr
Match: XP_008466425.1 (PREDICTED: charged multivesicular body protein 7 isoform X1 [Cucumis melo] >XP_008466434.1 PREDICTED: charged multivesicular body protein 7 isoform X1 [Cucumis melo] >XP_008466443.1 PREDICTED: charged multivesicular body protein 7 isoform X1 [Cucumis melo] >XP_008466452.1 PREDICTED: charged multivesicular body protein 7 isoform X1 [Cucumis melo] >XP_008466460.1 PREDICTED: charged multivesicular body protein 7 isoform X1 [Cucumis melo]) HSP 1 Score: 86.7 bits (213), Expect = 3.1e-14 Identity = 47/60 (78.33%), Postives = 49/60 (81.67%), Query Frame = 0
BLAST of MELO3C026294.2 vs. NCBI nr
Match: XP_008466468.1 (PREDICTED: charged multivesicular body protein 7 isoform X2 [Cucumis melo]) HSP 1 Score: 86.7 bits (213), Expect = 3.1e-14 Identity = 47/60 (78.33%), Postives = 49/60 (81.67%), Query Frame = 0
BLAST of MELO3C026294.2 vs. NCBI nr
Match: XP_004151427.1 (PREDICTED: charged multivesicular body protein 7 [Cucumis sativus] >XP_011654554.1 PREDICTED: charged multivesicular body protein 7 [Cucumis sativus] >KGN49777.1 hypothetical protein Csa_5G118690 [Cucumis sativus]) HSP 1 Score: 84.0 bits (206), Expect = 2.0e-13 Identity = 46/60 (76.67%), Postives = 48/60 (80.00%), Query Frame = 0
BLAST of MELO3C026294.2 vs. NCBI nr
Match: XP_023551290.1 (charged multivesicular body protein 7 [Cucurbita pepo subsp. pepo] >XP_023551291.1 charged multivesicular body protein 7 [Cucurbita pepo subsp. pepo] >XP_023551292.1 charged multivesicular body protein 7 [Cucurbita pepo subsp. pepo] >XP_023551293.1 charged multivesicular body protein 7 [Cucurbita pepo subsp. pepo] >XP_023551294.1 charged multivesicular body protein 7 [Cucurbita pepo subsp. pepo] >XP_023551295.1 charged multivesicular body protein 7 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 60.1 bits (144), Expect = 3.1e-06 Identity = 37/57 (64.91%), Postives = 41/57 (71.93%), Query Frame = 0
BLAST of MELO3C026294.2 vs. NCBI nr
Match: XP_022938857.1 (charged multivesicular body protein 7 [Cucurbita moschata] >XP_022938858.1 charged multivesicular body protein 7 [Cucurbita moschata] >XP_022938859.1 charged multivesicular body protein 7 [Cucurbita moschata] >XP_022938860.1 charged multivesicular body protein 7 [Cucurbita moschata] >XP_022938861.1 charged multivesicular body protein 7 [Cucurbita moschata]) HSP 1 Score: 58.5 bits (140), Expect = 8.9e-06 Identity = 37/57 (64.91%), Postives = 40/57 (70.18%), Query Frame = 0
BLAST of MELO3C026294.2 vs. TrEMBL
Match: tr|A0A1S3CRA4|A0A1S3CRA4_CUCME (charged multivesicular body protein 7 isoform X1 OS=Cucumis melo OX=3656 GN=LOC103503835 PE=3 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 2.0e-14 Identity = 47/60 (78.33%), Postives = 49/60 (81.67%), Query Frame = 0
BLAST of MELO3C026294.2 vs. TrEMBL
Match: tr|A0A1S3CRC5|A0A1S3CRC5_CUCME (charged multivesicular body protein 7 isoform X2 OS=Cucumis melo OX=3656 GN=LOC103503835 PE=3 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 2.0e-14 Identity = 47/60 (78.33%), Postives = 49/60 (81.67%), Query Frame = 0
BLAST of MELO3C026294.2 vs. TrEMBL
Match: tr|A0A0A0KMY2|A0A0A0KMY2_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G118690 PE=3 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 1.3e-13 Identity = 46/60 (76.67%), Postives = 48/60 (80.00%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |