MELO3C026165 (gene) Melon (DHL92) v3.5.1

NameMELO3C026165
Typegene
OrganismCucumis melo (Melon (DHL92) v3.5.1)
DescriptionPhosphoglycerate mutase-like protein
Locationchr2 : 26084167 .. 26084352 (-)
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGACAGCTGATTGGAAGGTGTTCACACTCGGTATGACATTCAACAATGGATCCTCTAGGGTTGTGTTACATGGTGACCCAGCTAGCACGCATGGAAATGTCATTGAAAATGCTTTCGAAAATGTGGGTGGAGAAGGATCAGGGCTTTCTAATAGAGTTCAAGGAACAAAGGTTGCAGAGCTCTAA

mRNA sequence

ATGACAGCTGATTGGAAGGTGTTCACACTCGGTATGACATTCAACAATGGATCCTCTAGGGTTGTGTTACATGGTGACCCAGCTAGCACGCATGGAAATGTCATTGAAAATGCTTTCGAAAATGTGGGTGGAGAAGGATCAGGGCTTTCTAATAGAGTTCAAGGAACAAAGGTTGCAGAGCTCTAA

Coding sequence (CDS)

ATGACAGCTGATTGGAAGGTGTTCACACTCGGTATGACATTCAACAATGGATCCTCTAGGGTTGTGTTACATGGTGACCCAGCTAGCACGCATGGAAATGTCATTGAAAATGCTTTCGAAAATGTGGGTGGAGAAGGATCAGGGCTTTCTAATAGAGTTCAAGGAACAAAGGTTGCAGAGCTCTAA

Protein sequence

MTADWKVFTLGMTFNNGSSRVVLHGDPASTHGNVIENAFENVGGEGSGLSNRVQGTKVAEL*
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0008150 biological_process
cellular_component GO:0005575 cellular_component
molecular_function GO:0003674 molecular_function

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
MELO3C026165T1MELO3C026165T1mRNA


The following gene(s) are orthologous to this gene:

None

The following gene(s) are paralogous to this gene:

None

The following block(s) are covering this gene:
GeneOrganismBlock
MELO3C026165Cucurbita pepo (Zucchini)cpemeB328
MELO3C026165Cucurbita pepo (Zucchini)cpemeB484
MELO3C026165Cucurbita pepo (Zucchini)cpemeB615
MELO3C026165Bottle gourd (USVL1VR-Ls)lsimeB207
MELO3C026165Bottle gourd (USVL1VR-Ls)lsimeB397
MELO3C026165Cucumber (Gy14) v2cgybmeB046
MELO3C026165Cucumber (Gy14) v2cgybmeB048
MELO3C026165Cucumber (Gy14) v2cgybmeB165
MELO3C026165Silver-seed gourdcarmeB0369
MELO3C026165Silver-seed gourdcarmeB0612
MELO3C026165Cucumber (Chinese Long) v3cucmeB053
MELO3C026165Cucumber (Chinese Long) v3cucmeB051
MELO3C026165Cucumber (Chinese Long) v3cucmeB196
MELO3C026165Watermelon (97103) v2mewmbB248
MELO3C026165Watermelon (97103) v2mewmbB261
MELO3C026165Wax gourdmewgoB282
MELO3C026165Wax gourdmewgoB309
MELO3C026165Melon (DHL92) v3.5.1memeB046
MELO3C026165Melon (DHL92) v3.5.1memeB067
MELO3C026165Melon (DHL92) v3.5.1memeB112
MELO3C026165Cucumber (Gy14) v1cgymeB264
MELO3C026165Cucurbita maxima (Rimu)cmameB065
MELO3C026165Cucurbita maxima (Rimu)cmameB121
MELO3C026165Cucurbita maxima (Rimu)cmameB208
MELO3C026165Cucurbita moschata (Rifu)cmomeB057
MELO3C026165Cucurbita moschata (Rifu)cmomeB109
MELO3C026165Cucurbita moschata (Rifu)cmomeB192
MELO3C026165Wild cucumber (PI 183967)cpimeB052
MELO3C026165Wild cucumber (PI 183967)cpimeB055
MELO3C026165Wild cucumber (PI 183967)cpimeB191
MELO3C026165Cucumber (Chinese Long) v2cumeB051
MELO3C026165Cucumber (Chinese Long) v2cumeB054
MELO3C026165Cucumber (Chinese Long) v2cumeB198
MELO3C026165Watermelon (Charleston Gray)mewcgB244
MELO3C026165Watermelon (Charleston Gray)mewcgB254
MELO3C026165Watermelon (97103) v1mewmB269
MELO3C026165Watermelon (97103) v1mewmB289