MELO3C026100 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTTGCGATGGTGAGGGCGAGCTCCGGCTTGCAATATCCCGATCGGTTCTACGCCGTGGCTTCTTATGTCGGTTTTGATGGATCATCGAAATTGTCTTCAAAGGCCCTCAGGTCTAAGTTCTCTGATGAGGCCACTTTGTTACTCTATGGCTTGTATCAGCAGGTACTACCACGTGTTCTTACACCTGTGACTTACCGGTGCTGTTTCAGTTTGGTTGAGGTTTGA ATGGTTGCGATGGTGAGGGCGAGCTCCGGCTTGCAATATCCCGATCGGTTCTACGCCGTGGCTTCTTATGTCGGTTTTGATGGATCATCGAAATTGTCTTCAAAGGCCCTCAGGTCTAAGTTCTCTGATGAGGCCACTTTGTTACTCTATGGCTTGTATCAGCAGGTACTACCACGTGTTCTTACACCTGTGACTTACCGGTGCTGTTTCAGTTTGGTTGAGGTTTGA ATGGTTGCGATGGTGAGGGCGAGCTCCGGCTTGCAATATCCCGATCGGTTCTACGCCGTGGCTTCTTATGTCGGTTTTGATGGATCATCGAAATTGTCTTCAAAGGCCCTCAGGTCTAAGTTCTCTGATGAGGCCACTTTGTTACTCTATGGCTTGTATCAGCAGGTACTACCACGTGTTCTTACACCTGTGACTTACCGGTGCTGTTTCAGTTTGGTTGAGGTTTGA MVAMVRASSGLQYPDRFYAVASYVGFDGSSKLSSKALRSKFSDEATLLLYGLYQQVLPRVLTPVTYRCCFSLVEV*
BLAST of MELO3C026100 vs. Swiss-Prot
Match: ACBP5_ARATH (Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 9.1e-12 Identity = 37/55 (67.27%), Postives = 40/55 (72.73%), Query Frame = 1
BLAST of MELO3C026100 vs. Swiss-Prot
Match: ACBP4_ARATH (Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 2.2e-10 Identity = 34/54 (62.96%), Postives = 38/54 (70.37%), Query Frame = 1
BLAST of MELO3C026100 vs. TrEMBL
Match: A0A0A0LFW3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G030060 PE=4 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 1.3e-17 Identity = 48/55 (87.27%), Postives = 48/55 (87.27%), Query Frame = 1
BLAST of MELO3C026100 vs. TrEMBL
Match: M5WQY4_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa002406mg PE=4 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 1.2e-13 Identity = 39/54 (72.22%), Postives = 46/54 (85.19%), Query Frame = 1
BLAST of MELO3C026100 vs. TrEMBL
Match: D7U9T2_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_14s0060g02410 PE=4 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 2.9e-12 Identity = 38/54 (70.37%), Postives = 42/54 (77.78%), Query Frame = 1
BLAST of MELO3C026100 vs. TrEMBL
Match: K4B0X2_SOLLC (Uncharacterized protein OS=Solanum lycopersicum PE=4 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 6.4e-12 Identity = 37/54 (68.52%), Postives = 43/54 (79.63%), Query Frame = 1
BLAST of MELO3C026100 vs. TrEMBL
Match: M1CAR8_SOLTU (Uncharacterized protein OS=Solanum tuberosum GN=PGSC0003DMG400024701 PE=4 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 6.4e-12 Identity = 37/54 (68.52%), Postives = 43/54 (79.63%), Query Frame = 1
BLAST of MELO3C026100 vs. TAIR10
Match: AT5G27630.1 (AT5G27630.1 acyl-CoA binding protein 5) HSP 1 Score: 70.5 bits (171), Expect = 5.1e-13 Identity = 37/55 (67.27%), Postives = 40/55 (72.73%), Query Frame = 1
BLAST of MELO3C026100 vs. TAIR10
Match: AT3G05420.2 (AT3G05420.2 acyl-CoA binding protein 4) HSP 1 Score: 65.9 bits (159), Expect = 1.3e-11 Identity = 34/54 (62.96%), Postives = 38/54 (70.37%), Query Frame = 1
BLAST of MELO3C026100 vs. NCBI nr
Match: gi|659125410|ref|XP_008462673.1| (PREDICTED: acyl-CoA-binding domain-containing protein 5-like [Cucumis melo]) HSP 1 Score: 99.0 bits (245), Expect = 3.8e-18 Identity = 49/55 (89.09%), Postives = 49/55 (89.09%), Query Frame = 1
BLAST of MELO3C026100 vs. NCBI nr
Match: gi|449454077|ref|XP_004144782.1| (PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform X1 [Cucumis sativus]) HSP 1 Score: 96.7 bits (239), Expect = 1.9e-17 Identity = 48/55 (87.27%), Postives = 48/55 (87.27%), Query Frame = 1
BLAST of MELO3C026100 vs. NCBI nr
Match: gi|778666903|ref|XP_011648837.1| (PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform X2 [Cucumis sativus]) HSP 1 Score: 96.7 bits (239), Expect = 1.9e-17 Identity = 48/55 (87.27%), Postives = 48/55 (87.27%), Query Frame = 1
BLAST of MELO3C026100 vs. NCBI nr
Match: gi|659070284|ref|XP_008454338.1| (PREDICTED: acyl-CoA-binding domain-containing protein 4-like isoform X1 [Cucumis melo]) HSP 1 Score: 96.7 bits (239), Expect = 1.9e-17 Identity = 48/55 (87.27%), Postives = 48/55 (87.27%), Query Frame = 1
BLAST of MELO3C026100 vs. NCBI nr
Match: gi|659070286|ref|XP_008454347.1| (PREDICTED: acyl-CoA-binding domain-containing protein 4-like isoform X2 [Cucumis melo]) HSP 1 Score: 96.7 bits (239), Expect = 1.9e-17 Identity = 48/55 (87.27%), Postives = 48/55 (87.27%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|