MELO3C026066 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCAGGCAAGAATTTTGGCTCTTAATGCCTCATATTTTCTAAAAGCCGGTGGTCATTTTGTTATATCAATCAAGGTGAGTCACAGTCAACTTTTTGATAAAAGTGAAAGATGGTATAGTATAACCCATACACCCAAAGATGATTTGTTTTATATTTAACTTTGTAGGCCAACTGCATAGACTCTACCGTTCCAGCAGAGGCAGTGTTTGCAAGTGAGGTGAATAAGTTAAAAGCAGATCAGTTCAAACCGACTGAGCAAGTAACACTTGAACCATTCGAGCGAGATCATGCCTGTGTTGTCGGTATTTATCGGGCGCCAAAGAAACAAAAGGCTGCTGCCTAG ATGCAGGCAAGAATTTTGGCTCTTAATGCCTCATATTTTCTAAAAGCCGGTGGTCATTTTGTTATATCAATCAAGGCCAACTGCATAGACTCTACCGTTCCAGCAGAGGCAGTGTTTGCAAGTGAGGTGAATAAGTTAAAAGCAGATCAGTTCAAACCGACTGAGCAAGTAACACTTGAACCATTCGAGCGAGATCATGCCTGTGTTGTCGGTATTTATCGGGCGCCAAAGAAACAAAAGGCTGCTGCCTAG ATGCAGGCAAGAATTTTGGCTCTTAATGCCTCATATTTTCTAAAAGCCGGTGGTCATTTTGTTATATCAATCAAGGCCAACTGCATAGACTCTACCGTTCCAGCAGAGGCAGTGTTTGCAAGTGAGGTGAATAAGTTAAAAGCAGATCAGTTCAAACCGACTGAGCAAGTAACACTTGAACCATTCGAGCGAGATCATGCCTGTGTTGTCGGTATTTATCGGGCGCCAAAGAAACAAAAGGCTGCTGCCTAG MQARILALNASYFLKAGGHFVISIKANCIDSTVPAEAVFASEVNKLKADQFKPTEQVTLEPFERDHACVVGIYRAPKKQKAAA*
BLAST of MELO3C026066 vs. Swiss-Prot
Match: MD36A_ARATH (Mediator of RNA polymerase II transcription subunit 36a OS=Arabidopsis thaliana GN=MED36A PE=1 SV=2) HSP 1 Score: 142.1 bits (357), Expect = 2.7e-33 Identity = 70/81 (86.42%), Postives = 72/81 (88.89%), Query Frame = 1
BLAST of MELO3C026066 vs. Swiss-Prot
Match: MD36B_ARATH (Probable mediator of RNA polymerase II transcription subunit 36b OS=Arabidopsis thaliana GN=MED36B PE=1 SV=1) HSP 1 Score: 138.7 bits (348), Expect = 3.0e-32 Identity = 69/82 (84.15%), Postives = 70/82 (85.37%), Query Frame = 1
BLAST of MELO3C026066 vs. Swiss-Prot
Match: FBRL_DROER (rRNA 2'-O-methyltransferase fibrillarin OS=Drosophila erecta GN=Fib PE=3 SV=1) HSP 1 Score: 119.4 bits (298), Expect = 1.9e-26 Identity = 57/78 (73.08%), Postives = 64/78 (82.05%), Query Frame = 1
BLAST of MELO3C026066 vs. Swiss-Prot
Match: FBRL_DROME (rRNA 2'-O-methyltransferase fibrillarin OS=Drosophila melanogaster GN=Fib PE=2 SV=1) HSP 1 Score: 118.2 bits (295), Expect = 4.2e-26 Identity = 56/78 (71.79%), Postives = 64/78 (82.05%), Query Frame = 1
BLAST of MELO3C026066 vs. Swiss-Prot
Match: FBRL_LEIMA (rRNA 2'-O-methyltransferase fibrillarin OS=Leishmania major PE=3 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 9.4e-26 Identity = 58/79 (73.42%), Postives = 63/79 (79.75%), Query Frame = 1
BLAST of MELO3C026066 vs. TrEMBL
Match: A0A0A0L9V7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G183360 PE=3 SV=1) HSP 1 Score: 164.5 bits (415), Expect = 5.7e-38 Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 1
BLAST of MELO3C026066 vs. TrEMBL
Match: A0A0A0KLF9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G174640 PE=3 SV=1) HSP 1 Score: 164.5 bits (415), Expect = 5.7e-38 Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 1
BLAST of MELO3C026066 vs. TrEMBL
Match: M1AMW1_SOLTU (Uncharacterized protein OS=Solanum tuberosum GN=PGSC0003DMG400010119 PE=3 SV=1) HSP 1 Score: 153.7 bits (387), Expect = 1.0e-34 Identity = 76/82 (92.68%), Postives = 77/82 (93.90%), Query Frame = 1
BLAST of MELO3C026066 vs. TrEMBL
Match: A0A0V0HVU1_SOLCH (Putative mediator of RNA polymerase II transcription subunit 36a-like OS=Solanum chacoense PE=3 SV=1) HSP 1 Score: 153.7 bits (387), Expect = 1.0e-34 Identity = 76/82 (92.68%), Postives = 77/82 (93.90%), Query Frame = 1
BLAST of MELO3C026066 vs. TrEMBL
Match: A0A165XFK6_DAUCA (Uncharacterized protein OS=Daucus carota subsp. sativus GN=DCAR_014514 PE=4 SV=1) HSP 1 Score: 152.1 bits (383), Expect = 2.9e-34 Identity = 75/80 (93.75%), Postives = 77/80 (96.25%), Query Frame = 1
BLAST of MELO3C026066 vs. TAIR10
Match: AT4G25630.1 (AT4G25630.1 fibrillarin 2) HSP 1 Score: 142.1 bits (357), Expect = 1.5e-34 Identity = 70/81 (86.42%), Postives = 72/81 (88.89%), Query Frame = 1
BLAST of MELO3C026066 vs. TAIR10
Match: AT5G52470.1 (AT5G52470.1 fibrillarin 1) HSP 1 Score: 138.7 bits (348), Expect = 1.7e-33 Identity = 69/82 (84.15%), Postives = 70/82 (85.37%), Query Frame = 1
BLAST of MELO3C026066 vs. TAIR10
Match: AT5G52490.1 (AT5G52490.1 Fibrillarin family protein) HSP 1 Score: 97.8 bits (242), Expect = 3.3e-21 Identity = 47/77 (61.04%), Postives = 58/77 (75.32%), Query Frame = 1
BLAST of MELO3C026066 vs. NCBI nr
Match: gi|449446011|ref|XP_004140765.1| (PREDICTED: mediator of RNA polymerase II transcription subunit 36a-like [Cucumis sativus]) HSP 1 Score: 164.5 bits (415), Expect = 8.2e-38 Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 1
BLAST of MELO3C026066 vs. NCBI nr
Match: gi|778700668|ref|XP_004143621.2| (PREDICTED: probable mediator of RNA polymerase II transcription subunit 36b [Cucumis sativus]) HSP 1 Score: 164.5 bits (415), Expect = 8.2e-38 Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 1
BLAST of MELO3C026066 vs. NCBI nr
Match: gi|659077616|ref|XP_008439295.1| (PREDICTED: mediator of RNA polymerase II transcription subunit 36a-like [Cucumis melo]) HSP 1 Score: 164.5 bits (415), Expect = 8.2e-38 Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 1
BLAST of MELO3C026066 vs. NCBI nr
Match: gi|659073002|ref|XP_008467209.1| (PREDICTED: probable mediator of RNA polymerase II transcription subunit 36b [Cucumis melo]) HSP 1 Score: 162.9 bits (411), Expect = 2.4e-37 Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 1
BLAST of MELO3C026066 vs. NCBI nr
Match: gi|565374712|ref|XP_006353900.1| (PREDICTED: mediator of RNA polymerase II transcription subunit 36a-like [Solanum tuberosum]) HSP 1 Score: 153.7 bits (387), Expect = 1.4e-34 Identity = 76/82 (92.68%), Postives = 77/82 (93.90%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |