MELO3C025947 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTATGCAACTCTTGCAAGCAGGGACGTAGACTGTTGTTTAATTCCAGAGTCACATTTCTATCTCGAAGGTCCTGGTGGACTTTATGAATACATAGCAAGATGTCTCAAACACAACGACCACATGGTTATTATCATTGCAAAAGGAGTTGGACAGGAGTTGCTTTCTGGAAGCTTTGGTTCTGATAAGCAGAATGCTTCTGGAAATAAGCTTCTTCAAGATATTGGGCTATGGCTATCGCAAAGAATCAAGGTTTGGTTTTCAATGTGCTTTTTGTTACCTAAAAGAGAACACTGTTTAGTGTCTACCGTCTTTTCGTATTCATATATTGCCAACCTCTGTTCAGTTTGTTAGCATTAATCTCTAA ATGTATGCAACTCTTGCAAGCAGGGACGTAGACTGTTGTTTAATTCCAGAGTCACATTTCTATCTCGAAGGTCCTGGTGGACTTTATGAATACATAGCAAGATGTCTCAAACACAACGACCACATGGTTATTATCATTGCAAAAGGAGTTGGACAGGAGTTGCTTTCTGGAAGCTTTGGTTCTGATAAGCAGAATGCTTCTGGAAATAAGCTTCTTCAAGATATTGGGCTATGGCTATCGCAAAGAATCAAGTTTGTTAGCATTAATCTCTAA ATGTATGCAACTCTTGCAAGCAGGGACGTAGACTGTTGTTTAATTCCAGAGTCACATTTCTATCTCGAAGGTCCTGGTGGACTTTATGAATACATAGCAAGATGTCTCAAACACAACGACCACATGGTTATTATCATTGCAAAAGGAGTTGGACAGGAGTTGCTTTCTGGAAGCTTTGGTTCTGATAAGCAGAATGCTTCTGGAAATAAGCTTCTTCAAGATATTGGGCTATGGCTATCGCAAAGAATCAAGTTTGTTAGCATTAATCTCTAA MYATLASRDVDCCLIPESHFYLEGPGGLYEYIARCLKHNDHMVIIIAKGVGQELLSGSFGSDKQNASGNKLLQDIGLWLSQRIKFVSINL*
BLAST of MELO3C025947 vs. Swiss-Prot
Match: PFKA6_ARATH (ATP-dependent 6-phosphofructokinase 6 OS=Arabidopsis thaliana GN=PFK6 PE=1 SV=1) HSP 1 Score: 122.1 bits (305), Expect = 3.2e-27 Identity = 58/84 (69.05%), Postives = 71/84 (84.52%), Query Frame = 1
BLAST of MELO3C025947 vs. Swiss-Prot
Match: PFKA7_ARATH (ATP-dependent 6-phosphofructokinase 7 OS=Arabidopsis thaliana GN=PFK7 PE=1 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 4.1e-27 Identity = 58/84 (69.05%), Postives = 67/84 (79.76%), Query Frame = 1
BLAST of MELO3C025947 vs. Swiss-Prot
Match: PFKA3_ARATH (ATP-dependent 6-phosphofructokinase 3 OS=Arabidopsis thaliana GN=PFK3 PE=1 SV=1) HSP 1 Score: 119.8 bits (299), Expect = 1.6e-26 Identity = 59/85 (69.41%), Postives = 69/85 (81.18%), Query Frame = 1
BLAST of MELO3C025947 vs. Swiss-Prot
Match: PFKA1_ARATH (ATP-dependent 6-phosphofructokinase 1 OS=Arabidopsis thaliana GN=PFK1 PE=1 SV=1) HSP 1 Score: 118.6 bits (296), Expect = 3.5e-26 Identity = 59/86 (68.60%), Postives = 70/86 (81.40%), Query Frame = 1
BLAST of MELO3C025947 vs. Swiss-Prot
Match: PFKA4_ARATH (ATP-dependent 6-phosphofructokinase 4, chloroplastic OS=Arabidopsis thaliana GN=PFK4 PE=1 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 1.2e-23 Identity = 53/85 (62.35%), Postives = 68/85 (80.00%), Query Frame = 1
BLAST of MELO3C025947 vs. TrEMBL
Match: A0A0A0LWB9_CUCSA (ATP-dependent 6-phosphofructokinase OS=Cucumis sativus GN=PFK PE=3 SV=1) HSP 1 Score: 157.5 bits (397), Expect = 7.6e-36 Identity = 76/84 (90.48%), Postives = 79/84 (94.05%), Query Frame = 1
BLAST of MELO3C025947 vs. TrEMBL
Match: M5W6F1_PRUPE (ATP-dependent 6-phosphofructokinase OS=Prunus persica GN=PFK PE=3 SV=1) HSP 1 Score: 134.8 bits (338), Expect = 5.2e-29 Identity = 67/85 (78.82%), Postives = 74/85 (87.06%), Query Frame = 1
BLAST of MELO3C025947 vs. TrEMBL
Match: A0A061GM22_THECC (ATP-dependent 6-phosphofructokinase OS=Theobroma cacao GN=PFK PE=3 SV=1) HSP 1 Score: 134.8 bits (338), Expect = 5.2e-29 Identity = 67/85 (78.82%), Postives = 74/85 (87.06%), Query Frame = 1
BLAST of MELO3C025947 vs. TrEMBL
Match: A0A067KPP6_JATCU (ATP-dependent 6-phosphofructokinase OS=Jatropha curcas GN=PFK PE=3 SV=1) HSP 1 Score: 134.0 bits (336), Expect = 8.9e-29 Identity = 62/84 (73.81%), Postives = 74/84 (88.10%), Query Frame = 1
BLAST of MELO3C025947 vs. TrEMBL
Match: G7KHY6_MEDTR (ATP-dependent 6-phosphofructokinase OS=Medicago truncatula GN=PFK PE=3 SV=1) HSP 1 Score: 133.7 bits (335), Expect = 1.2e-28 Identity = 67/85 (78.82%), Postives = 73/85 (85.88%), Query Frame = 1
BLAST of MELO3C025947 vs. TAIR10
Match: AT4G32840.1 (AT4G32840.1 phosphofructokinase 6) HSP 1 Score: 122.1 bits (305), Expect = 1.8e-28 Identity = 58/84 (69.05%), Postives = 71/84 (84.52%), Query Frame = 1
BLAST of MELO3C025947 vs. TAIR10
Match: AT5G56630.1 (AT5G56630.1 phosphofructokinase 7) HSP 1 Score: 121.7 bits (304), Expect = 2.3e-28 Identity = 58/84 (69.05%), Postives = 67/84 (79.76%), Query Frame = 1
BLAST of MELO3C025947 vs. TAIR10
Match: AT4G26270.1 (AT4G26270.1 phosphofructokinase 3) HSP 1 Score: 119.8 bits (299), Expect = 8.8e-28 Identity = 59/85 (69.41%), Postives = 69/85 (81.18%), Query Frame = 1
BLAST of MELO3C025947 vs. TAIR10
Match: AT4G29220.1 (AT4G29220.1 phosphofructokinase 1) HSP 1 Score: 118.6 bits (296), Expect = 2.0e-27 Identity = 59/86 (68.60%), Postives = 70/86 (81.40%), Query Frame = 1
BLAST of MELO3C025947 vs. TAIR10
Match: AT5G61580.1 (AT5G61580.1 phosphofructokinase 4) HSP 1 Score: 110.2 bits (274), Expect = 7.0e-25 Identity = 53/85 (62.35%), Postives = 68/85 (80.00%), Query Frame = 1
BLAST of MELO3C025947 vs. NCBI nr
Match: gi|659128412|ref|XP_008464192.1| (PREDICTED: LOW QUALITY PROTEIN: 6-phosphofructokinase 3-like [Cucumis melo]) HSP 1 Score: 176.0 bits (445), Expect = 2.9e-41 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 1
BLAST of MELO3C025947 vs. NCBI nr
Match: gi|659099842|ref|XP_008450803.1| (PREDICTED: 6-phosphofructokinase 7-like [Cucumis melo]) HSP 1 Score: 160.6 bits (405), Expect = 1.3e-36 Identity = 77/84 (91.67%), Postives = 80/84 (95.24%), Query Frame = 1
BLAST of MELO3C025947 vs. NCBI nr
Match: gi|449435798|ref|XP_004135681.1| (PREDICTED: ATP-dependent 6-phosphofructokinase 7-like [Cucumis sativus]) HSP 1 Score: 157.5 bits (397), Expect = 1.1e-35 Identity = 76/84 (90.48%), Postives = 79/84 (94.05%), Query Frame = 1
BLAST of MELO3C025947 vs. NCBI nr
Match: gi|502164183|ref|XP_004513074.1| (PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Cicer arietinum]) HSP 1 Score: 137.1 bits (344), Expect = 1.5e-29 Identity = 68/84 (80.95%), Postives = 74/84 (88.10%), Query Frame = 1
BLAST of MELO3C025947 vs. NCBI nr
Match: gi|470102102|ref|XP_004287498.1| (PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Fragaria vesca subsp. vesca]) HSP 1 Score: 135.2 bits (339), Expect = 5.8e-29 Identity = 66/85 (77.65%), Postives = 75/85 (88.24%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |