MELO3C025842 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.GCACTACAGATTTAAAAGGTTTGGCTGTATACACCTTAAACCTTGCTCATACAAATGCTCGCAAATCTTTGACCCTAGCCAACTCACTAGCAAAAACCACCACCAATCCTCAACTTAAGCAACGATATTCGTCTTGTGTTGAGAGCTATGATGAAGCTGTTGGTGATATTGAAAATGTCCAAAAGGACTTGGCACTTGGTGACTTTAACGGTGTCAATATTGTAACTTCTGGTGCCATGACAGAGATTGACGACTGTCAAGATAAGTTCGCGCAGCCACCAAAGGATACGTCGTTGCTTTTGAAGAATGGCAAGACTCTAAATGATATATGCAGCATTATTTTGGTTATATCCAATCTTCTTTGA GCACTACAGATTTAAAAGGTTTGGCTGTATACACCTTAAACCTTGCTCATACAAATGCTCGCAAATCTTTGACCCTAGCCAACTCACTAGCAAAAACCACCACCAATCCTCAACTTAAGCAACGATATTCGTCTTGTGTTGAGAGCTATGATGAAGCTGTTGGTGATATTGAAAATGTCCAAAAGGACTTGGCACTTGGTGACTTTAACGGTGTCAATATTGTAACTTCTGGTGCCATGACAGAGATTGACGACTGTCAAGATAAGTTCGCGCAGCCACCAAAGGATACGTCGTTGCTTTTGAAGAATGGCAAGACTCTAAATGATATATGCAGCATTATTTTGGTTATATCCAATCTTCTTTGA GCACTACAGATTTAAAAGGTTTGGCTGTATACACCTTAAACCTTGCTCATACAAATGCTCGCAAATCTTTGACCCTAGCCAACTCACTAGCAAAAACCACCACCAATCCTCAACTTAAGCAACGATATTCGTCTTGTGTTGAGAGCTATGATGAAGCTGTTGGTGATATTGAAAATGTCCAAAAGGACTTGGCACTTGGTGACTTTAACGGTGTCAATATTGTAACTTCTGGTGCCATGACAGAGATTGACGACTGTCAAGATAAGTTCGCGCAGCCACCAAAGGATACGTCGTTGCTTTTGAAGAATGGCAAGACTCTAAATGATATATGCAGCATTATTTTGGTTATATCCAATCTTCTTTGA TTDLKGLAVYTLNLAHTNARKSLTLANSLAKTTTNPQLKQRYSSCVESYDEAVGDIENVQKDLALGDFNGVNIVTSGAMTEIDDCQDKFAQPPKDTSLLLKNGKTLNDICSIILVISNLL*
BLAST of MELO3C025842 vs. Swiss-Prot
Match: PMEI_ACTDE (Pectinesterase inhibitor OS=Actinidia deliciosa GN=PMEI PE=1 SV=2) HSP 1 Score: 91.3 bits (225), Expect = 7.9e-18 Identity = 44/118 (37.29%), Postives = 68/118 (57.63%), Query Frame = 1
BLAST of MELO3C025842 vs. Swiss-Prot
Match: PMEI2_ARATH (Pectinesterase inhibitor 2 OS=Arabidopsis thaliana GN=PMEI2 PE=1 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 9.7e-16 Identity = 46/118 (38.98%), Postives = 63/118 (53.39%), Query Frame = 1
BLAST of MELO3C025842 vs. Swiss-Prot
Match: PMEI1_ARATH (Pectinesterase inhibitor 1 OS=Arabidopsis thaliana GN=PMEI1 PE=1 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 2.0e-13 Identity = 41/118 (34.75%), Postives = 63/118 (53.39%), Query Frame = 1
BLAST of MELO3C025842 vs. Swiss-Prot
Match: PLA1_PLAAC (Putative invertase inhibitor OS=Platanus acerifolia PE=1 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 2.0e-08 Identity = 35/120 (29.17%), Postives = 55/120 (45.83%), Query Frame = 1
BLAST of MELO3C025842 vs. TrEMBL
Match: A0A0A0KCV8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G307340 PE=4 SV=1) HSP 1 Score: 217.6 bits (553), Expect = 8.2e-54 Identity = 109/119 (91.60%), Postives = 112/119 (94.12%), Query Frame = 1
BLAST of MELO3C025842 vs. TrEMBL
Match: A0A0A0KEW6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G307350 PE=4 SV=1) HSP 1 Score: 152.9 bits (385), Expect = 2.5e-34 Identity = 81/120 (67.50%), Postives = 90/120 (75.00%), Query Frame = 1
BLAST of MELO3C025842 vs. TrEMBL
Match: A0A0A0KCC4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G307360 PE=4 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 4.5e-28 Identity = 69/118 (58.47%), Postives = 82/118 (69.49%), Query Frame = 1
BLAST of MELO3C025842 vs. TrEMBL
Match: V4LWJ6_EUTSA (Uncharacterized protein OS=Eutrema salsugineum GN=EUTSA_v10022367mg PE=4 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 3.0e-16 Identity = 50/118 (42.37%), Postives = 70/118 (59.32%), Query Frame = 1
BLAST of MELO3C025842 vs. TrEMBL
Match: A0A072TNA9_MEDTR (Plant invertase/pectin methylesterase inhibitor OS=Medicago truncatula GN=MTR_8g032810 PE=4 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 4.0e-16 Identity = 50/122 (40.98%), Postives = 75/122 (61.48%), Query Frame = 1
BLAST of MELO3C025842 vs. TAIR10
Match: AT3G17220.1 (AT3G17220.1 pectin methylesterase inhibitor 2) HSP 1 Score: 84.3 bits (207), Expect = 5.5e-17 Identity = 46/118 (38.98%), Postives = 63/118 (53.39%), Query Frame = 1
BLAST of MELO3C025842 vs. TAIR10
Match: AT1G48020.1 (AT1G48020.1 pectin methylesterase inhibitor 1) HSP 1 Score: 76.6 bits (187), Expect = 1.1e-14 Identity = 41/118 (34.75%), Postives = 63/118 (53.39%), Query Frame = 1
BLAST of MELO3C025842 vs. TAIR10
Match: AT1G48010.1 (AT1G48010.1 Plant invertase/pectin methylesterase inhibitor superfamily protein) HSP 1 Score: 57.8 bits (138), Expect = 5.5e-09 Identity = 38/123 (30.89%), Postives = 61/123 (49.59%), Query Frame = 1
BLAST of MELO3C025842 vs. TAIR10
Match: AT3G05741.1 (AT3G05741.1 Plant invertase/pectin methylesterase inhibitor superfamily protein) HSP 1 Score: 53.9 bits (128), Expect = 7.9e-08 Identity = 29/97 (29.90%), Postives = 47/97 (48.45%), Query Frame = 1
BLAST of MELO3C025842 vs. NCBI nr
Match: gi|659128306|ref|XP_008464144.1| (PREDICTED: pectinesterase inhibitor-like [Cucumis melo]) HSP 1 Score: 238.0 bits (606), Expect = 8.4e-60 Identity = 120/120 (100.00%), Postives = 120/120 (100.00%), Query Frame = 1
BLAST of MELO3C025842 vs. NCBI nr
Match: gi|659127944|ref|XP_008463970.1| (PREDICTED: pectinesterase inhibitor-like [Cucumis melo]) HSP 1 Score: 224.6 bits (571), Expect = 9.6e-56 Identity = 114/120 (95.00%), Postives = 114/120 (95.00%), Query Frame = 1
BLAST of MELO3C025842 vs. NCBI nr
Match: gi|659117593|ref|XP_008458683.1| (PREDICTED: pectinesterase inhibitor [Cucumis melo]) HSP 1 Score: 223.8 bits (569), Expect = 1.6e-55 Identity = 112/120 (93.33%), Postives = 114/120 (95.00%), Query Frame = 1
BLAST of MELO3C025842 vs. NCBI nr
Match: gi|659087170|ref|XP_008444309.1| (PREDICTED: pectinesterase inhibitor-like [Cucumis melo]) HSP 1 Score: 218.8 bits (556), Expect = 5.3e-54 Identity = 110/120 (91.67%), Postives = 113/120 (94.17%), Query Frame = 1
BLAST of MELO3C025842 vs. NCBI nr
Match: gi|659113907|ref|XP_008456812.1| (PREDICTED: pectinesterase inhibitor-like [Cucumis melo]) HSP 1 Score: 218.4 bits (555), Expect = 6.9e-54 Identity = 108/119 (90.76%), Postives = 113/119 (94.96%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|