MELO3C025808 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGACTCTGTCTCTGCCGAGCCTTCTAAGTGGCTTCATCCTCCATTCTCCGCTGTCCGAACCTTCGATGGTAAAATCTTCGCCCATGGTTCTCAAGATGACAAGTCTATCGCCATCCAATATCTTGAAGCCATTCGGAATCTCAGAAACCAGGATTTCATCCCTGTCCGTACGGTTCATATATCGTATGTACCGAATGAGGAGATTGGCGGTTTCGATGGAGCTGCGAAGTCCGTTCAGTCAAAGGAGTTCAAGGAGTTGAATGTAGGGTTTATGATGGATGAAGGACAAGCTTCACCGGGAGATGAGTTTAGGGTTGGATACTGTTAG ATGGACTCTGTCTCTGCCGAGCCTTCTAAGTGGCTTCATCCTCCATTCTCCGCTGTCCGAACCTTCGATGGTAAAATCTTCGCCCATGGTTCTCAAGATGACAAGTCTATCGCCATCCAATATCTTGAAGCCATTCGGAATCTCAGAAACCAGGATTTCATCCCTGTCCGTACGGTTCATATATCGTATGTACCGAATGAGGAGATTGGCGGTTTCGATGGAGCTGCGAAGTCCGTTCAGTCAAAGGAGTTCAAGGAGTTGAATGTAGGGTTTATGATGGATGAAGGACAAGCTTCACCGGGAGATGAGTTTAGGGTTGGATACTGTTAG ATGGACTCTGTCTCTGCCGAGCCTTCTAAGTGGCTTCATCCTCCATTCTCCGCTGTCCGAACCTTCGATGGTAAAATCTTCGCCCATGGTTCTCAAGATGACAAGTCTATCGCCATCCAATATCTTGAAGCCATTCGGAATCTCAGAAACCAGGATTTCATCCCTGTCCGTACGGTTCATATATCGTATGTACCGAATGAGGAGATTGGCGGTTTCGATGGAGCTGCGAAGTCCGTTCAGTCAAAGGAGTTCAAGGAGTTGAATGTAGGGTTTATGATGGATGAAGGACAAGCTTCACCGGGAGATGAGTTTAGGGTTGGATACTGTTAG MDSVSAEPSKWLHPPFSAVRTFDGKIFAHGSQDDKSIAIQYLEAIRNLRNQDFIPVRTVHISYVPNEEIGGFDGAAKSVQSKEFKELNVGFMMDEGQASPGDEFRVGYC*
BLAST of MELO3C025808 vs. Swiss-Prot
Match: ACY1_MOUSE (Aminoacylase-1 OS=Mus musculus GN=Acy1 PE=1 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 9.1e-21 Identity = 49/107 (45.79%), Postives = 66/107 (61.68%), Query Frame = 1
BLAST of MELO3C025808 vs. Swiss-Prot
Match: ACY1A_RAT (Aminoacylase-1A OS=Rattus norvegicus GN=Acy1a PE=1 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 2.0e-20 Identity = 48/107 (44.86%), Postives = 66/107 (61.68%), Query Frame = 1
BLAST of MELO3C025808 vs. Swiss-Prot
Match: ACY1_PONAB (Aminoacylase-1 OS=Pongo abelii GN=ACY1 PE=2 SV=2) HSP 1 Score: 97.8 bits (242), Expect = 7.7e-20 Identity = 49/107 (45.79%), Postives = 63/107 (58.88%), Query Frame = 1
BLAST of MELO3C025808 vs. Swiss-Prot
Match: ACY1_HUMAN (Aminoacylase-1 OS=Homo sapiens GN=ACY1 PE=1 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 1.0e-19 Identity = 48/107 (44.86%), Postives = 63/107 (58.88%), Query Frame = 1
BLAST of MELO3C025808 vs. Swiss-Prot
Match: ACY1_PIG (Aminoacylase-1 OS=Sus scrofa GN=ACY1 PE=1 SV=2) HSP 1 Score: 96.7 bits (239), Expect = 1.7e-19 Identity = 47/107 (43.93%), Postives = 62/107 (57.94%), Query Frame = 1
BLAST of MELO3C025808 vs. TrEMBL
Match: A0A0A0LRI1_CUCSA (Aminoacylase-1 OS=Cucumis sativus GN=Csa_1G005600 PE=3 SV=1) HSP 1 Score: 198.0 bits (502), Expect = 6.1e-48 Identity = 96/108 (88.89%), Postives = 101/108 (93.52%), Query Frame = 1
BLAST of MELO3C025808 vs. TrEMBL
Match: F6H0T0_VITVI (Aminoacylase-1 OS=Vitis vinifera GN=VIT_18s0001g03230 PE=3 SV=1) HSP 1 Score: 176.8 bits (447), Expect = 1.5e-41 Identity = 86/108 (79.63%), Postives = 94/108 (87.04%), Query Frame = 1
BLAST of MELO3C025808 vs. TrEMBL
Match: M5XPL6_PRUPE (Aminoacylase-1 OS=Prunus persica GN=PRUPE_ppa005883mg PE=3 SV=1) HSP 1 Score: 172.6 bits (436), Expect = 2.7e-40 Identity = 80/108 (74.07%), Postives = 93/108 (86.11%), Query Frame = 1
BLAST of MELO3C025808 vs. TrEMBL
Match: A0A059BZ79_EUCGR (Aminoacylase-1 OS=Eucalyptus grandis GN=EUGRSUZ_F04363 PE=3 SV=1) HSP 1 Score: 171.4 bits (433), Expect = 6.1e-40 Identity = 79/108 (73.15%), Postives = 96/108 (88.89%), Query Frame = 1
BLAST of MELO3C025808 vs. TrEMBL
Match: B9RJ69_RICCO (Aminoacylase-1 OS=Ricinus communis GN=RCOM_1031900 PE=3 SV=1) HSP 1 Score: 171.4 bits (433), Expect = 6.1e-40 Identity = 81/108 (75.00%), Postives = 93/108 (86.11%), Query Frame = 1
BLAST of MELO3C025808 vs. TAIR10
Match: AT1G44180.1 (AT1G44180.1 Peptidase M20/M25/M40 family protein) HSP 1 Score: 162.2 bits (409), Expect = 1.9e-40 Identity = 75/108 (69.44%), Postives = 86/108 (79.63%), Query Frame = 1
BLAST of MELO3C025808 vs. TAIR10
Match: AT1G44820.1 (AT1G44820.1 Peptidase M20/M25/M40 family protein) HSP 1 Score: 156.8 bits (395), Expect = 7.9e-39 Identity = 72/108 (66.67%), Postives = 85/108 (78.70%), Query Frame = 1
BLAST of MELO3C025808 vs. TAIR10
Match: AT4G38220.2 (AT4G38220.2 Peptidase M20/M25/M40 family protein) HSP 1 Score: 110.5 bits (275), Expect = 6.5e-25 Identity = 54/107 (50.47%), Postives = 69/107 (64.49%), Query Frame = 1
BLAST of MELO3C025808 vs. NCBI nr
Match: gi|700208503|gb|KGN63599.1| (hypothetical protein Csa_1G005600 [Cucumis sativus]) HSP 1 Score: 198.0 bits (502), Expect = 8.8e-48 Identity = 96/108 (88.89%), Postives = 101/108 (93.52%), Query Frame = 1
BLAST of MELO3C025808 vs. NCBI nr
Match: gi|659072268|ref|XP_008464599.1| (PREDICTED: LOW QUALITY PROTEIN: aminoacylase-1-like [Cucumis melo]) HSP 1 Score: 196.4 bits (498), Expect = 2.5e-47 Identity = 97/109 (88.99%), Postives = 98/109 (89.91%), Query Frame = 1
BLAST of MELO3C025808 vs. NCBI nr
Match: gi|225459515|ref|XP_002285843.1| (PREDICTED: aminoacylase-1 [Vitis vinifera]) HSP 1 Score: 176.8 bits (447), Expect = 2.1e-41 Identity = 86/108 (79.63%), Postives = 94/108 (87.04%), Query Frame = 1
BLAST of MELO3C025808 vs. NCBI nr
Match: gi|596134410|ref|XP_007222264.1| (hypothetical protein PRUPE_ppa005883mg [Prunus persica]) HSP 1 Score: 172.6 bits (436), Expect = 3.9e-40 Identity = 80/108 (74.07%), Postives = 93/108 (86.11%), Query Frame = 1
BLAST of MELO3C025808 vs. NCBI nr
Match: gi|702383051|ref|XP_010063988.1| (PREDICTED: aminoacylase-1 isoform X2 [Eucalyptus grandis]) HSP 1 Score: 171.4 bits (433), Expect = 8.8e-40 Identity = 79/108 (73.15%), Postives = 96/108 (88.89%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|