MELO3C025672 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTACTGGTGGGCATGGTGTACCTCTGTTGGGAAGTCCTGATGGTCAGTACCTTTGTATACTTGACAGAAACCTCATTATGTCACAAAATATGAGTTGAAATTACATATTTCAAGCTTGTCAATTTCAAATTTCCTTGATGAAACTGTTGTTTCTAATTTGTAAGCTTCCTAGTGGTGGTTAGATTGTGATCTACGGAAATATTATTAGAAGTACATGAAATGTGTCTTTTCGTTTGTAAATCTTGATTATGCACCTAGATACTTCATTATCTTTCCTCACTTTCTCATTCCATTTTCAGGTAGGGTCAGATATAAATATGCATCATTTTGGAATAGGAACCATGTGGTTAGAGCTTTACAGCACACAGTGAATAACTTCCGTGAAATGCTGGAAGCTGAGAAGAAGGCATGTTCCTTAGACCTTAGGTTTTTCTTTTCGTTGATATTTCTTGTTGTTTTTGTTTTATTTATTTATTTACTTATTTATTATTATTTGTTATAA ATGGGTACTGGTGGGCATGGTGTACCTCTGTTGGGAAGTCCTGATGGTAGGGTCAGATATAAATATGCATCATTTTGGAATAGGAACCATGTGGTTAGAGCTTTACAGCACACAGTGAATAACTTCCGTGAAATGCTGGAAGCTGAGAAGAAGGCATGTTCCTTAGACCTTAGGTTTTTCTTTTCGTTGATATTTCTTGTTGTTTTTGTTTTATTTATTTATTTACTTATTTATTATTATTTGTTATAA ATGGGTACTGGTGGGCATGGTGTACCTCTGTTGGGAAGTCCTGATGGTAGGGTCAGATATAAATATGCATCATTTTGGAATAGGAACCATGTGGTTAGAGCTTTACAGCACACAGTGAATAACTTCCGTGAAATGCTGGAAGCTGAGAAGAAGGCATGTTCCTTAGACCTTAGGTTTTTCTTTTCGTTGATATTTCTTGTTGTTTTTGTTTTATTTATTTATTTACTTATTTATTATTATTTGTTATAA MGTGGHGVPLLGSPDGRVRYKYASFWNRNHVVRALQHTVNNFREMLEAEKKACSLDLRFFFSLIFLVVFVLFIYLLIYYYLL*
BLAST of MELO3C025672 vs. Swiss-Prot
Match: BAGP1_ARATH (BAG-associated GRAM protein 1 OS=Arabidopsis thaliana GN=BAGP1 PE=1 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 4.6e-17 Identity = 38/51 (74.51%), Postives = 41/51 (80.39%), Query Frame = 1
BLAST of MELO3C025672 vs. TrEMBL
Match: A0A0A0KTV0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G011670 PE=4 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 1.0e-18 Identity = 46/51 (90.20%), Postives = 48/51 (94.12%), Query Frame = 1
BLAST of MELO3C025672 vs. TrEMBL
Match: G7JNL7_MEDTR (C2 and GRAM domain plant-like protein OS=Medicago truncatula GN=MTR_4g087320 PE=4 SV=2) HSP 1 Score: 93.6 bits (231), Expect = 1.2e-16 Identity = 42/51 (82.35%), Postives = 44/51 (86.27%), Query Frame = 1
BLAST of MELO3C025672 vs. TrEMBL
Match: G7JNL8_MEDTR (C2 and GRAM domain plant-like protein OS=Medicago truncatula GN=MTR_4g087320 PE=4 SV=2) HSP 1 Score: 93.6 bits (231), Expect = 1.2e-16 Identity = 42/51 (82.35%), Postives = 44/51 (86.27%), Query Frame = 1
BLAST of MELO3C025672 vs. TrEMBL
Match: A0A058ZXE0_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_L00003 PE=4 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.0e-15 Identity = 40/51 (78.43%), Postives = 45/51 (88.24%), Query Frame = 1
BLAST of MELO3C025672 vs. TrEMBL
Match: A0A061EJY3_THECC (C2 domain-containing protein / GRAM domain-containing protein isoform 6 (Fragment) OS=Theobroma cacao GN=TCM_019867 PE=4 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.0e-15 Identity = 40/51 (78.43%), Postives = 43/51 (84.31%), Query Frame = 1
BLAST of MELO3C025672 vs. TAIR10
Match: AT3G59660.1 (AT3G59660.1 C2 domain-containing protein / GRAM domain-containing protein) HSP 1 Score: 88.2 bits (217), Expect = 2.6e-18 Identity = 38/51 (74.51%), Postives = 41/51 (80.39%), Query Frame = 1
BLAST of MELO3C025672 vs. NCBI nr
Match: gi|659127592|ref|XP_008463782.1| (PREDICTED: uncharacterized protein LOC103501844 isoform X2 [Cucumis melo]) HSP 1 Score: 111.3 bits (277), Expect = 8.1e-22 Identity = 51/51 (100.00%), Postives = 51/51 (100.00%), Query Frame = 1
BLAST of MELO3C025672 vs. NCBI nr
Match: gi|659127594|ref|XP_008463783.1| (PREDICTED: uncharacterized protein LOC103501844 isoform X3 [Cucumis melo]) HSP 1 Score: 111.3 bits (277), Expect = 8.1e-22 Identity = 51/51 (100.00%), Postives = 51/51 (100.00%), Query Frame = 1
BLAST of MELO3C025672 vs. NCBI nr
Match: gi|659127590|ref|XP_008463781.1| (PREDICTED: uncharacterized protein LOC103501844 isoform X1 [Cucumis melo]) HSP 1 Score: 111.3 bits (277), Expect = 8.1e-22 Identity = 51/51 (100.00%), Postives = 51/51 (100.00%), Query Frame = 1
BLAST of MELO3C025672 vs. NCBI nr
Match: gi|659130158|ref|XP_008465028.1| (PREDICTED: uncharacterized protein LOC103502745 [Cucumis melo]) HSP 1 Score: 102.4 bits (254), Expect = 3.8e-19 Identity = 46/51 (90.20%), Postives = 49/51 (96.08%), Query Frame = 1
BLAST of MELO3C025672 vs. NCBI nr
Match: gi|449468844|ref|XP_004152131.1| (PREDICTED: C2 and GRAM domain-containing protein At1g03370 [Cucumis sativus]) HSP 1 Score: 100.5 bits (249), Expect = 1.4e-18 Identity = 46/51 (90.20%), Postives = 48/51 (94.12%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|