MELO3C025661 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.GCCTTGAGAAGCATTGTTTGCATTTGGACTGGCCAATAAGAATGAAGATATGTGTGGGAATAGCAAAGGGGTTGGCTTACCTTCATGAAGAATCTAGATTGAAAATTGTTCATAGAGATACAAAGGCTACTAATGTTCTACTTGATGAAAACTTGAATGCCAAGATCTCTGACTTTGGATTGGCTAAGCTTCACGAAGAGGTCATGTTAGCACAAAAATTGTAG GCCTTGAGAAGCATTGTTTGCATTTGGACTGGCCAATAAGAATGAAGATATGTGTGGGAATAGCAAAGGGGTTGGCTTACCTTCATGAAGAATCTAGATTGAAAATTGTTCATAGAGATACAAAGGCTACTAATGTTCTACTTGATGAAAACTTGAATGCCAAGATCTCTGACTTTGGATTGGCTAAGCTTCACGAAGAGGTCATGTTAGCACAAAAATTGTAG GCCTTGAGAAGCATTGTTTGCATTTGGACTGGCCAATAAGAATGAAGATATGTGTGGGAATAGCAAAGGGGTTGGCTTACCTTCATGAAGAATCTAGATTGAAAATTGTTCATAGAGATACAAAGGCTACTAATGTTCTACTTGATGAAAACTTGAATGCCAAGATCTCTGACTTTGGATTGGCTAAGCTTCACGAAGAGGTCATGTTAGCACAAAAATTGTAG LEKHCLHLDWPIRMKICVGIAKGLAYLHEESRLKIVHRDTKATNVLLDENLNAKISDFGLAKLHEEVMLAQKL*
BLAST of MELO3C025661 vs. Swiss-Prot
Match: Y5344_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g53440 OS=Arabidopsis thaliana GN=At1g53440 PE=2 SV=2) HSP 1 Score: 110.2 bits (274), Expect = 1.0e-23 Identity = 54/65 (83.08%), Postives = 55/65 (84.62%), Query Frame = 1
BLAST of MELO3C025661 vs. Swiss-Prot
Match: Y5343_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g53430 OS=Arabidopsis thaliana GN=At1g53430 PE=1 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 2.3e-23 Identity = 53/65 (81.54%), Postives = 56/65 (86.15%), Query Frame = 1
BLAST of MELO3C025661 vs. Swiss-Prot
Match: Y1534_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g53420 OS=Arabidopsis thaliana GN=At1g53420 PE=2 SV=2) HSP 1 Score: 105.9 bits (263), Expect = 1.9e-22 Identity = 50/61 (81.97%), Postives = 52/61 (85.25%), Query Frame = 1
BLAST of MELO3C025661 vs. Swiss-Prot
Match: Y3148_ARATH (Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 OS=Arabidopsis thaliana GN=LRR-RLK PE=2 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 5.5e-22 Identity = 50/59 (84.75%), Postives = 52/59 (88.14%), Query Frame = 1
BLAST of MELO3C025661 vs. Swiss-Prot
Match: RKF1_ARATH (Probable LRR receptor-like serine/threonine-protein kinase RFK1 OS=Arabidopsis thaliana GN=RKF1 PE=1 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 4.4e-19 Identity = 44/59 (74.58%), Postives = 48/59 (81.36%), Query Frame = 1
BLAST of MELO3C025661 vs. TrEMBL
Match: A0A068UCP3_COFCA (Uncharacterized protein OS=Coffea canephora GN=GSCOC_T00021394001 PE=4 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 8.6e-22 Identity = 52/65 (80.00%), Postives = 58/65 (89.23%), Query Frame = 1
BLAST of MELO3C025661 vs. TrEMBL
Match: F6H1V3_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_19s0014g00830 PE=4 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 1.1e-21 Identity = 53/65 (81.54%), Postives = 59/65 (90.77%), Query Frame = 1
BLAST of MELO3C025661 vs. TrEMBL
Match: F6H1V3_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_19s0014g00830 PE=4 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 5.6e-21 Identity = 52/61 (85.25%), Postives = 57/61 (93.44%), Query Frame = 1
HSP 2 Score: 109.4 bits (272), Expect = 1.9e-21 Identity = 52/66 (78.79%), Postives = 58/66 (87.88%), Query Frame = 1
BLAST of MELO3C025661 vs. TrEMBL
Match: A0A103YJY9_CYNCS (Uncharacterized protein (Fragment) OS=Cynara cardunculus var. scolymus GN=Ccrd_011065 PE=4 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 1.2e-20 Identity = 52/65 (80.00%), Postives = 56/65 (86.15%), Query Frame = 1
BLAST of MELO3C025661 vs. TrEMBL
Match: A0A103YJY9_CYNCS (Uncharacterized protein (Fragment) OS=Cynara cardunculus var. scolymus GN=Ccrd_011065 PE=4 SV=1) HSP 1 Score: 104.0 bits (258), Expect = 8.1e-20 Identity = 52/65 (80.00%), Postives = 57/65 (87.69%), Query Frame = 1
HSP 2 Score: 106.3 bits (264), Expect = 1.6e-20 Identity = 52/65 (80.00%), Postives = 58/65 (89.23%), Query Frame = 1
BLAST of MELO3C025661 vs. TAIR10
Match: AT1G53440.1 (AT1G53440.1 Leucine-rich repeat transmembrane protein kinase) HSP 1 Score: 110.2 bits (274), Expect = 5.7e-25 Identity = 54/65 (83.08%), Postives = 55/65 (84.62%), Query Frame = 1
BLAST of MELO3C025661 vs. TAIR10
Match: AT1G53430.1 (AT1G53430.1 Leucine-rich repeat transmembrane protein kinase) HSP 1 Score: 109.0 bits (271), Expect = 1.3e-24 Identity = 53/65 (81.54%), Postives = 56/65 (86.15%), Query Frame = 1
BLAST of MELO3C025661 vs. TAIR10
Match: AT1G53420.1 (AT1G53420.1 Leucine-rich repeat transmembrane protein kinase) HSP 1 Score: 105.9 bits (263), Expect = 1.1e-23 Identity = 50/61 (81.97%), Postives = 52/61 (85.25%), Query Frame = 1
BLAST of MELO3C025661 vs. TAIR10
Match: AT3G14840.2 (AT3G14840.2 Leucine-rich repeat transmembrane protein kinase) HSP 1 Score: 104.4 bits (259), Expect = 3.1e-23 Identity = 50/59 (84.75%), Postives = 52/59 (88.14%), Query Frame = 1
BLAST of MELO3C025661 vs. TAIR10
Match: AT1G29730.1 (AT1G29730.1 Leucine-rich repeat transmembrane protein kinase) HSP 1 Score: 97.8 bits (242), Expect = 2.9e-21 Identity = 43/64 (67.19%), Postives = 54/64 (84.38%), Query Frame = 1
BLAST of MELO3C025661 vs. NCBI nr
Match: gi|778695665|ref|XP_011654031.1| (PREDICTED: LOW QUALITY PROTEIN: probable LRR receptor-like serine/threonine-protein kinase At1g53440 [Cucumis sativus]) HSP 1 Score: 128.3 bits (321), Expect = 5.7e-27 Identity = 62/65 (95.38%), Postives = 63/65 (96.92%), Query Frame = 1
BLAST of MELO3C025661 vs. NCBI nr
Match: gi|700199886|gb|KGN55044.1| (hypothetical protein Csa_4G624990 [Cucumis sativus]) HSP 1 Score: 128.3 bits (321), Expect = 5.7e-27 Identity = 62/65 (95.38%), Postives = 63/65 (96.92%), Query Frame = 1
BLAST of MELO3C025661 vs. NCBI nr
Match: gi|659127575|ref|XP_008463773.1| (PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g53440 [Cucumis melo]) HSP 1 Score: 116.3 bits (290), Expect = 2.3e-23 Identity = 56/65 (86.15%), Postives = 60/65 (92.31%), Query Frame = 1
BLAST of MELO3C025661 vs. NCBI nr
Match: gi|593262238|ref|XP_007133298.1| (hypothetical protein PHAVU_011G167800g [Phaseolus vulgaris]) HSP 1 Score: 115.2 bits (287), Expect = 5.0e-23 Identity = 56/65 (86.15%), Postives = 59/65 (90.77%), Query Frame = 1
BLAST of MELO3C025661 vs. NCBI nr
Match: gi|674242964|gb|KFK35729.1| (hypothetical protein AALP_AA4G029100 [Arabis alpina]) HSP 1 Score: 115.2 bits (287), Expect = 5.0e-23 Identity = 55/65 (84.62%), Postives = 60/65 (92.31%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|