MELO3C025138.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGACCGGCTGGAGGCGGCGGAGGAACGTGTTCTTCGACCCCTTCGCATTGGAGAACTGGGATTCATCTGAAGAAACAGCCTCTGCTTTCATGGACACTCAAATCGACTGGAAAGAGACGCCAAATGCTCACATCTTCAAGGAGAATCTTCCTGGTTTGAAAATAGAAGAAGTGAATGGATGTTAA ATGACCGGCTGGAGGCGGCGGAGGAACGTGTTCTTCGACCCCTTCGCATTGGAGAACTGGGATTCATCTGAAGAAACAGCCTCTGCTTTCATGGACACTCAAATCGACTGGAAAGAGACGCCAAATGCTCACATCTTCAAGGAGAATCTTCCTGGTTTGAAAATAGAAGAAGTGAATGGATGTTAA ATGACCGGCTGGAGGCGGCGGAGGAACGTGTTCTTCGACCCCTTCGCATTGGAGAACTGGGATTCATCTGAAGAAACAGCCTCTGCTTTCATGGACACTCAAATCGACTGGAAAGAGACGCCAAATGCTCACATCTTCAAGGAGAATCTTCCTGGTTTGAAAATAGAAGAAGTGAATGGATGTTAA MTGWRRRRNVFFDPFALENWDSSEETASAFMDTQIDWKETPNAHIFKENLPGLKIEEVNGC
BLAST of MELO3C025138.2 vs. NCBI nr
Match: XP_004150237.2 (PREDICTED: 18.1 kDa class I heat shock protein-like [Cucumis sativus] >KGN50619.1 hypothetical protein Csa_5G197110 [Cucumis sativus]) HSP 1 Score: 114.4 bits (285), Expect = 1.4e-22 Identity = 53/59 (89.83%), Postives = 55/59 (93.22%), Query Frame = 0
BLAST of MELO3C025138.2 vs. NCBI nr
Match: KZM91942.1 (hypothetical protein DCAR_020693 [Daucus carota subsp. sativus]) HSP 1 Score: 70.9 bits (172), Expect = 1.7e-09 Identity = 32/54 (59.26%), Postives = 43/54 (79.63%), Query Frame = 0
BLAST of MELO3C025138.2 vs. NCBI nr
Match: XP_006424969.1 (18.1 kDa class I heat shock protein [Citrus clementina] >XP_006488428.1 18.1 kDa class I heat shock protein [Citrus sinensis] >ESR38209.1 hypothetical protein CICLE_v10029495mg [Citrus clementina] >KDO66698.1 hypothetical protein CISIN_1g031937mg [Citrus sinensis] >GAY37959.1 hypothetical protein CUMW_033020 [Citrus unshiu]) HSP 1 Score: 69.7 bits (169), Expect = 3.9e-09 Identity = 31/58 (53.45%), Postives = 43/58 (74.14%), Query Frame = 0
BLAST of MELO3C025138.2 vs. NCBI nr
Match: XP_019261477.1 (PREDICTED: 17.6 kDa class I heat shock protein-like [Nicotiana attenuata] >OIT38460.1 17.6 kda class i heat shock protein [Nicotiana attenuata]) HSP 1 Score: 69.3 bits (168), Expect = 5.1e-09 Identity = 31/61 (50.82%), Postives = 42/61 (68.85%), Query Frame = 0
BLAST of MELO3C025138.2 vs. NCBI nr
Match: XP_019158556.1 (PREDICTED: 17.5 kDa class I heat shock protein-like [Ipomoea nil]) HSP 1 Score: 69.3 bits (168), Expect = 5.1e-09 Identity = 33/61 (54.10%), Postives = 43/61 (70.49%), Query Frame = 0
BLAST of MELO3C025138.2 vs. TAIR10
Match: AT2G29500.1 (HSP20-like chaperones superfamily protein) HSP 1 Score: 63.2 bits (152), Expect = 6.6e-11 Identity = 29/60 (48.33%), Postives = 40/60 (66.67%), Query Frame = 0
BLAST of MELO3C025138.2 vs. TAIR10
Match: AT1G59860.1 (HSP20-like chaperones superfamily protein) HSP 1 Score: 62.0 bits (149), Expect = 1.5e-10 Identity = 29/60 (48.33%), Postives = 40/60 (66.67%), Query Frame = 0
BLAST of MELO3C025138.2 vs. TAIR10
Match: AT1G07400.1 (HSP20-like chaperones superfamily protein) HSP 1 Score: 61.6 bits (148), Expect = 1.9e-10 Identity = 30/65 (46.15%), Postives = 39/65 (60.00%), Query Frame = 0
BLAST of MELO3C025138.2 vs. TAIR10
Match: AT3G46230.1 (heat shock protein 17.4) HSP 1 Score: 60.5 bits (145), Expect = 4.3e-10 Identity = 30/65 (46.15%), Postives = 41/65 (63.08%), Query Frame = 0
BLAST of MELO3C025138.2 vs. TAIR10
Match: AT5G59720.1 (heat shock protein 18.2) HSP 1 Score: 59.7 bits (143), Expect = 7.3e-10 Identity = 29/67 (43.28%), Postives = 39/67 (58.21%), Query Frame = 0
BLAST of MELO3C025138.2 vs. Swiss-Prot
Match: sp|P02519|HSP11_SOYBN (17.3 kDa class I heat shock protein OS=Glycine max OX=3847 GN=HSP17.3-B PE=3 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 2.4e-10 Identity = 31/61 (50.82%), Postives = 40/61 (65.57%), Query Frame = 0
BLAST of MELO3C025138.2 vs. Swiss-Prot
Match: sp|P04794|HSP14_SOYBN (17.5 kDa class I heat shock protein OS=Glycine max OX=3847 GN=HSP17.5-E PE=3 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 3.1e-10 Identity = 31/62 (50.00%), Postives = 40/62 (64.52%), Query Frame = 0
BLAST of MELO3C025138.2 vs. Swiss-Prot
Match: sp|O82011|HSP11_SOLPE (17.7 kDa class I heat shock protein OS=Solanum peruvianum OX=4082 PE=2 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 4.1e-10 Identity = 31/62 (50.00%), Postives = 41/62 (66.13%), Query Frame = 0
BLAST of MELO3C025138.2 vs. Swiss-Prot
Match: sp|P27396|HSP11_DAUCA (17.8 kDa class I heat shock protein OS=Daucus carota OX=4039 PE=3 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 5.3e-10 Identity = 34/66 (51.52%), Postives = 42/66 (63.64%), Query Frame = 0
BLAST of MELO3C025138.2 vs. Swiss-Prot
Match: sp|P19243|HSP11_PEA (18.1 kDa class I heat shock protein OS=Pisum sativum OX=3888 GN=HSP18.1 PE=1 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 7.0e-10 Identity = 33/66 (50.00%), Postives = 43/66 (65.15%), Query Frame = 0
BLAST of MELO3C025138.2 vs. TrEMBL
Match: tr|A0A0A0KP16|A0A0A0KP16_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G197110 PE=3 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 9.1e-23 Identity = 53/59 (89.83%), Postives = 55/59 (93.22%), Query Frame = 0
BLAST of MELO3C025138.2 vs. TrEMBL
Match: tr|A0A161ZVA1|A0A161ZVA1_DAUCA (Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_020693 PE=3 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 1.2e-09 Identity = 32/54 (59.26%), Postives = 43/54 (79.63%), Query Frame = 0
BLAST of MELO3C025138.2 vs. TrEMBL
Match: tr|V4UFW5|V4UFW5_9ROSI (Uncharacterized protein OS=Citrus clementina OX=85681 GN=CICLE_v10029495mg PE=3 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 2.6e-09 Identity = 31/58 (53.45%), Postives = 43/58 (74.14%), Query Frame = 0
BLAST of MELO3C025138.2 vs. TrEMBL
Match: tr|A0A2H5NCP3|A0A2H5NCP3_CITUN (Uncharacterized protein OS=Citrus unshiu OX=55188 GN=CUMW_033020 PE=3 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 2.6e-09 Identity = 31/58 (53.45%), Postives = 43/58 (74.14%), Query Frame = 0
BLAST of MELO3C025138.2 vs. TrEMBL
Match: tr|A0A067FH96|A0A067FH96_CITSI (Uncharacterized protein OS=Citrus sinensis OX=2711 GN=CISIN_1g031937mg PE=3 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 2.6e-09 Identity = 31/58 (53.45%), Postives = 43/58 (74.14%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|