MELO3C025077 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGACCATACAATTTTTCTACAAATTCTAAACTCATTTAAGTTCCATTTTCTCCTCAATTGTTGGTGGATGCTTACTTTACATCAGATAGGTTGGTAAAGACTTTTATCACGCACATGAACAGATTGGTTAATTTTCAACATTTTGATTGCTTTACTACTTGACTTATCTACTTTTTTGCGTCATCTACTTGAAGTAGTGATCTTGATATTTTTGATCTCTGTGATAAGTGCAACGATATTATTTTTGTAATATAATTATTTAATTTCATAATTATTTAATTTCATATATTATGACAGTTGTACCTTAAATCAATTTTTTACTTTTTCTATAAAACTCATTATTTTATAAATGTTTATTACAGGTCTTGATGTGGTTCGGACAGACAAAACATTGGTATTATATGAAAAGCAAGAAAACTTGTCAAAACTTTGGGATATTCTTGCTGTTTATGCCTGGATAGATAAAGACATCGATTACTGTCAAGGTGGGTAA ATGGACCATACAATTTTTCTACAAATTCTAAACTCATTTAAGTTCCATTTTCTCCTCAATTGTTGGTGGATGCTTACTTTACATCAGATAGGTCTTGATGTGGTTCGGACAGACAAAACATTGGTATTATATGAAAAGCAAGAAAACTTGTCAAAACTTTGGGATATTCTTGCTGTTTATGCCTGGATAGATAAAGACATCGATTACTGTCAAGGTGGGTAA ATGGACCATACAATTTTTCTACAAATTCTAAACTCATTTAAGTTCCATTTTCTCCTCAATTGTTGGTGGATGCTTACTTTACATCAGATAGGTCTTGATGTGGTTCGGACAGACAAAACATTGGTATTATATGAAAAGCAAGAAAACTTGTCAAAACTTTGGGATATTCTTGCTGTTTATGCCTGGATAGATAAAGACATCGATTACTGTCAAGGTGGGTAA MDHTIFLQILNSFKFHFLLNCWWMLTLHQIGLDVVRTDKTLVLYEKQENLSKLWDILAVYAWIDKDIDYCQGG*
BLAST of MELO3C025077 vs. TrEMBL
Match: A0A0A0L6C5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G078290 PE=4 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 1.4e-19 Identity = 46/50 (92.00%), Postives = 48/50 (96.00%), Query Frame = 1
BLAST of MELO3C025077 vs. TrEMBL
Match: A0A067EGB4_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g013868mg PE=4 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 5.2e-19 Identity = 43/50 (86.00%), Postives = 48/50 (96.00%), Query Frame = 1
BLAST of MELO3C025077 vs. TrEMBL
Match: A0A067E5B3_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g013868mg PE=4 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 5.2e-19 Identity = 43/50 (86.00%), Postives = 48/50 (96.00%), Query Frame = 1
BLAST of MELO3C025077 vs. TrEMBL
Match: V4UH55_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10008337mg PE=4 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 5.2e-19 Identity = 43/50 (86.00%), Postives = 48/50 (96.00%), Query Frame = 1
BLAST of MELO3C025077 vs. TrEMBL
Match: A0A067E4X2_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g013868mg PE=4 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 5.2e-19 Identity = 43/50 (86.00%), Postives = 48/50 (96.00%), Query Frame = 1
BLAST of MELO3C025077 vs. TAIR10
Match: AT5G54780.1 (AT5G54780.1 Ypt/Rab-GAP domain of gyp1p superfamily protein) HSP 1 Score: 94.7 bits (234), Expect = 2.5e-20 Identity = 41/50 (82.00%), Postives = 44/50 (88.00%), Query Frame = 1
BLAST of MELO3C025077 vs. TAIR10
Match: AT4G27100.1 (AT4G27100.1 Ypt/Rab-GAP domain of gyp1p superfamily protein) HSP 1 Score: 92.8 bits (229), Expect = 9.4e-20 Identity = 40/50 (80.00%), Postives = 43/50 (86.00%), Query Frame = 1
BLAST of MELO3C025077 vs. TAIR10
Match: AT2G20440.1 (AT2G20440.1 Ypt/Rab-GAP domain of gyp1p superfamily protein) HSP 1 Score: 76.3 bits (186), Expect = 9.1e-15 Identity = 32/50 (64.00%), Postives = 36/50 (72.00%), Query Frame = 1
BLAST of MELO3C025077 vs. TAIR10
Match: AT4G28550.1 (AT4G28550.1 Ypt/Rab-GAP domain of gyp1p superfamily protein) HSP 1 Score: 72.0 bits (175), Expect = 1.7e-13 Identity = 30/50 (60.00%), Postives = 36/50 (72.00%), Query Frame = 1
BLAST of MELO3C025077 vs. TAIR10
Match: AT2G43490.1 (AT2G43490.1 Ypt/Rab-GAP domain of gyp1p superfamily protein) HSP 1 Score: 64.3 bits (155), Expect = 3.6e-11 Identity = 29/50 (58.00%), Postives = 33/50 (66.00%), Query Frame = 1
BLAST of MELO3C025077 vs. NCBI nr
Match: gi|449470425|ref|XP_004152917.1| (PREDICTED: GTPase-activating protein gyp7-like [Cucumis sativus]) HSP 1 Score: 103.2 bits (256), Expect = 2.0e-19 Identity = 46/50 (92.00%), Postives = 48/50 (96.00%), Query Frame = 1
BLAST of MELO3C025077 vs. NCBI nr
Match: gi|700201014|gb|KGN56147.1| (hypothetical protein Csa_3G078290 [Cucumis sativus]) HSP 1 Score: 103.2 bits (256), Expect = 2.0e-19 Identity = 46/50 (92.00%), Postives = 48/50 (96.00%), Query Frame = 1
BLAST of MELO3C025077 vs. NCBI nr
Match: gi|659126939|ref|XP_008463439.1| (PREDICTED: GTPase-activating protein gyp7 [Cucumis melo]) HSP 1 Score: 103.2 bits (256), Expect = 2.0e-19 Identity = 46/50 (92.00%), Postives = 48/50 (96.00%), Query Frame = 1
BLAST of MELO3C025077 vs. NCBI nr
Match: gi|641831162|gb|KDO50229.1| (hypothetical protein CISIN_1g013868mg [Citrus sinensis]) HSP 1 Score: 101.3 bits (251), Expect = 7.5e-19 Identity = 43/50 (86.00%), Postives = 48/50 (96.00%), Query Frame = 1
BLAST of MELO3C025077 vs. NCBI nr
Match: gi|567920402|ref|XP_006452207.1| (hypothetical protein CICLE_v10008337mg [Citrus clementina]) HSP 1 Score: 101.3 bits (251), Expect = 7.5e-19 Identity = 43/50 (86.00%), Postives = 48/50 (96.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|