MELO3C024893 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGAATGTTGTCTACTAAAGCTAGCCATGATTCTCGTGGACAAAATCCCTCCTACTTCTTTGGATGGCAAGAGTACGAGAAGAACCCTTATCACCCTACTCAAAACCCCACCGGCATTATCCAAATGGCTCTTGCCGAAAACAAGTAA ATGGGAATGTTGTCTACTAAAGCTAGCCATGATTCTCGTGGACAAAATCCCTCCTACTTCTTTGGATGGCAAGAGTACGAGAAGAACCCTTATCACCCTACTCAAAACCCCACCGGCATTATCCAAATGGCTCTTGCCGAAAACAAGTAA ATGGGAATGTTGTCTACTAAAGCTAGCCATGATTCTCGTGGACAAAATCCCTCCTACTTCTTTGGATGGCAAGAGTACGAGAAGAACCCTTATCACCCTACTCAAAACCCCACCGGCATTATCCAAATGGCTCTTGCCGAAAACAAGTAA MGMLSTKASHDSRGQNPSYFFGWQEYEKNPYHPTQNPTGIIQMALAENK*
BLAST of MELO3C024893 vs. Swiss-Prot
Match: 1A18_ARATH (1-aminocyclopropane-1-carboxylate synthase 8 OS=Arabidopsis thaliana GN=ACS8 PE=1 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 1.6e-12 Identity = 32/49 (65.31%), Postives = 38/49 (77.55%), Query Frame = 1
BLAST of MELO3C024893 vs. Swiss-Prot
Match: 1A12_CUCMA (1-aminocyclopropane-1-carboxylate synthase CMA101 OS=Cucurbita maxima GN=ACS2 PE=2 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 2.1e-12 Identity = 32/49 (65.31%), Postives = 36/49 (73.47%), Query Frame = 1
BLAST of MELO3C024893 vs. Swiss-Prot
Match: 1A13_SOLLC (1-aminocyclopropane-1-carboxylate synthase 3 OS=Solanum lycopersicum GN=ACS3 PE=1 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 2.7e-12 Identity = 33/49 (67.35%), Postives = 36/49 (73.47%), Query Frame = 1
BLAST of MELO3C024893 vs. Swiss-Prot
Match: 1A1C_MALDO (1-aminocyclopropane-1-carboxylate synthase OS=Malus domestica GN=ACS-1 PE=1 SV=2) HSP 1 Score: 70.9 bits (172), Expect = 4.6e-12 Identity = 32/49 (65.31%), Postives = 34/49 (69.39%), Query Frame = 1
BLAST of MELO3C024893 vs. Swiss-Prot
Match: 1A11_ORYSI (1-aminocyclopropane-1-carboxylate synthase 1 OS=Oryza sativa subsp. indica GN=ACC1 PE=2 SV=2) HSP 1 Score: 70.9 bits (172), Expect = 4.6e-12 Identity = 31/47 (65.96%), Postives = 35/47 (74.47%), Query Frame = 1
BLAST of MELO3C024893 vs. TrEMBL
Match: A0A0S2C3P7_CUCME (ACS11 OS=Cucumis melo PE=3 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 1.5e-17 Identity = 42/49 (85.71%), Postives = 44/49 (89.80%), Query Frame = 1
BLAST of MELO3C024893 vs. TrEMBL
Match: Q71T07_MOMCH (1-aminocyclopropane-1-carboxylate synthase OS=Momordica charantia GN=ACS2 PE=3 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 7.4e-17 Identity = 41/49 (83.67%), Postives = 45/49 (91.84%), Query Frame = 1
BLAST of MELO3C024893 vs. TrEMBL
Match: K7KT63_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_06G049900 PE=3 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 1.1e-15 Identity = 40/49 (81.63%), Postives = 42/49 (85.71%), Query Frame = 1
BLAST of MELO3C024893 vs. TrEMBL
Match: K7KT62_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_06G049900 PE=3 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 1.1e-15 Identity = 40/49 (81.63%), Postives = 42/49 (85.71%), Query Frame = 1
BLAST of MELO3C024893 vs. TrEMBL
Match: A0A0B2SLG0_GLYSO (1-aminocyclopropane-1-carboxylate synthase OS=Glycine soja GN=glysoja_031345 PE=3 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 1.1e-15 Identity = 40/49 (81.63%), Postives = 42/49 (85.71%), Query Frame = 1
BLAST of MELO3C024893 vs. TAIR10
Match: AT4G37770.1 (AT4G37770.1 1-amino-cyclopropane-1-carboxylate synthase 8) HSP 1 Score: 72.4 bits (176), Expect = 8.9e-14 Identity = 32/49 (65.31%), Postives = 38/49 (77.55%), Query Frame = 1
BLAST of MELO3C024893 vs. TAIR10
Match: AT4G08040.1 (AT4G08040.1 1-aminocyclopropane-1-carboxylate synthase 11) HSP 1 Score: 68.9 bits (167), Expect = 9.8e-13 Identity = 30/47 (63.83%), Postives = 35/47 (74.47%), Query Frame = 1
BLAST of MELO3C024893 vs. TAIR10
Match: AT2G22810.1 (AT2G22810.1 1-aminocyclopropane-1-carboxylate synthase 4) HSP 1 Score: 68.2 bits (165), Expect = 1.7e-12 Identity = 32/49 (65.31%), Postives = 35/49 (71.43%), Query Frame = 1
BLAST of MELO3C024893 vs. TAIR10
Match: AT5G65800.1 (AT5G65800.1 ACC synthase 5) HSP 1 Score: 67.4 bits (163), Expect = 2.9e-12 Identity = 29/49 (59.18%), Postives = 34/49 (69.39%), Query Frame = 1
BLAST of MELO3C024893 vs. TAIR10
Match: AT3G49700.1 (AT3G49700.1 1-aminocyclopropane-1-carboxylate synthase 9) HSP 1 Score: 66.6 bits (161), Expect = 4.9e-12 Identity = 29/49 (59.18%), Postives = 34/49 (69.39%), Query Frame = 1
BLAST of MELO3C024893 vs. NCBI nr
Match: gi|950645968|gb|ALN38792.1| (ACS11 [Cucumis melo]) HSP 1 Score: 95.9 bits (237), Expect = 2.1e-17 Identity = 42/49 (85.71%), Postives = 44/49 (89.80%), Query Frame = 1
BLAST of MELO3C024893 vs. NCBI nr
Match: gi|659089525|ref|XP_008445556.1| (PREDICTED: 1-aminocyclopropane-1-carboxylate synthase CMA101-like [Cucumis melo]) HSP 1 Score: 95.9 bits (237), Expect = 2.1e-17 Identity = 42/49 (85.71%), Postives = 44/49 (89.80%), Query Frame = 1
BLAST of MELO3C024893 vs. NCBI nr
Match: gi|33339171|gb|AAQ14267.1|AF248736_1 (1-aminocyclopropane-1-carboxylate synthase [Momordica charantia]) HSP 1 Score: 93.6 bits (231), Expect = 1.1e-16 Identity = 41/49 (83.67%), Postives = 45/49 (91.84%), Query Frame = 1
BLAST of MELO3C024893 vs. NCBI nr
Match: gi|356518148|ref|XP_003527744.1| (PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 3-like [Glycine max]) HSP 1 Score: 89.7 bits (221), Expect = 1.5e-15 Identity = 40/49 (81.63%), Postives = 42/49 (85.71%), Query Frame = 1
BLAST of MELO3C024893 vs. NCBI nr
Match: gi|947103773|gb|KRH52156.1| (hypothetical protein GLYMA_06G049900 [Glycine max]) HSP 1 Score: 89.7 bits (221), Expect = 1.5e-15 Identity = 40/49 (81.63%), Postives = 42/49 (85.71%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|