MELO3C024892.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAGAAATACAAGGAAACAAAATGAAATTCGACATGAACAAACTGGTGCTCACCGCTGGTGCAACTGCTGCCAATGAAATCATCATATCTTGTCTTGTTGATCCCGCTGAAGCCTTCCTTGTTCCCACTCCTTACTATCCAGGGTAA ATGGAAGAAATACAAGGAAACAAAATGAAATTCGACATGAACAAACTGGTGCTCACCGCTGGTGCAACTGCTGCCAATGAAATCATCATATCTTGTCTTGTTGATCCCGCTGAAGCCTTCCTTGTTCCCACTCCTTACTATCCAGGGTAA ATGGAAGAAATACAAGGAAACAAAATGAAATTCGACATGAACAAACTGGTGCTCACCGCTGGTGCAACTGCTGCCAATGAAATCATCATATCTTGTCTTGTTGATCCCGCTGAAGCCTTCCTTGTTCCCACTCCTTACTATCCAGGGTAA MEEIQGNKMKFDMNKLVLTAGATAANEIIISCLVDPAEAFLVPTPYYPG
BLAST of MELO3C024892.2 vs. NCBI nr
Match: ALN38792.1 (ACS11 [Cucumis melo]) HSP 1 Score: 94.7 bits (234), Expect = 9.0e-17 Identity = 44/49 (89.80%), Postives = 47/49 (95.92%), Query Frame = 0
BLAST of MELO3C024892.2 vs. NCBI nr
Match: XP_008445556.2 (PREDICTED: 1-aminocyclopropane-1-carboxylate synthase CMA101-like isoform X1 [Cucumis melo]) HSP 1 Score: 94.7 bits (234), Expect = 9.0e-17 Identity = 44/49 (89.80%), Postives = 47/49 (95.92%), Query Frame = 0
BLAST of MELO3C024892.2 vs. NCBI nr
Match: XP_016900038.1 (PREDICTED: 1-aminocyclopropane-1-carboxylate synthase CMA101-like isoform X2 [Cucumis melo]) HSP 1 Score: 94.7 bits (234), Expect = 9.0e-17 Identity = 44/49 (89.80%), Postives = 47/49 (95.92%), Query Frame = 0
BLAST of MELO3C024892.2 vs. NCBI nr
Match: KGN62418.1 (hypothetical protein Csa_2G353460 [Cucumis sativus] >ALN38791.1 ACS11 [Cucumis sativus]) HSP 1 Score: 93.2 bits (230), Expect = 2.6e-16 Identity = 44/49 (89.80%), Postives = 46/49 (93.88%), Query Frame = 0
BLAST of MELO3C024892.2 vs. NCBI nr
Match: XP_004142909.2 (PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 3-like [Cucumis sativus]) HSP 1 Score: 93.2 bits (230), Expect = 2.6e-16 Identity = 44/49 (89.80%), Postives = 46/49 (93.88%), Query Frame = 0
BLAST of MELO3C024892.2 vs. TAIR10
Match: AT2G22810.1 (1-aminocyclopropane-1-carboxylate synthase 4) HSP 1 Score: 73.9 bits (180), Expect = 3.0e-14 Identity = 32/49 (65.31%), Postives = 40/49 (81.63%), Query Frame = 0
BLAST of MELO3C024892.2 vs. TAIR10
Match: AT4G37770.1 (1-amino-cyclopropane-1-carboxylate synthase 8) HSP 1 Score: 72.8 bits (177), Expect = 6.7e-14 Identity = 32/49 (65.31%), Postives = 40/49 (81.63%), Query Frame = 0
BLAST of MELO3C024892.2 vs. TAIR10
Match: AT3G49700.1 (1-aminocyclopropane-1-carboxylate synthase 9) HSP 1 Score: 72.4 bits (176), Expect = 8.7e-14 Identity = 30/49 (61.22%), Postives = 42/49 (85.71%), Query Frame = 0
BLAST of MELO3C024892.2 vs. TAIR10
Match: AT5G65800.1 (ACC synthase 5) HSP 1 Score: 72.0 bits (175), Expect = 1.1e-13 Identity = 30/49 (61.22%), Postives = 41/49 (83.67%), Query Frame = 0
BLAST of MELO3C024892.2 vs. TAIR10
Match: AT4G08040.1 (1-aminocyclopropane-1-carboxylate synthase 11) HSP 1 Score: 71.2 bits (173), Expect = 1.9e-13 Identity = 30/49 (61.22%), Postives = 41/49 (83.67%), Query Frame = 0
BLAST of MELO3C024892.2 vs. Swiss-Prot
Match: sp|P37821|1A1C_MALDO (1-aminocyclopropane-1-carboxylate synthase OS=Malus domestica OX=3750 GN=ACS-1 PE=1 SV=2) HSP 1 Score: 75.9 bits (185), Expect = 1.4e-13 Identity = 35/49 (71.43%), Postives = 39/49 (79.59%), Query Frame = 0
BLAST of MELO3C024892.2 vs. Swiss-Prot
Match: sp|Q43309|1A14_ARATH (1-aminocyclopropane-1-carboxylate synthase 4 OS=Arabidopsis thaliana OX=3702 GN=ACS4 PE=1 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 5.4e-13 Identity = 32/49 (65.31%), Postives = 40/49 (81.63%), Query Frame = 0
BLAST of MELO3C024892.2 vs. Swiss-Prot
Match: sp|Q9T065|1A18_ARATH (1-aminocyclopropane-1-carboxylate synthase 8 OS=Arabidopsis thaliana OX=3702 GN=ACS8 PE=1 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 1.2e-12 Identity = 32/49 (65.31%), Postives = 40/49 (81.63%), Query Frame = 0
BLAST of MELO3C024892.2 vs. Swiss-Prot
Match: sp|Q9M2Y8|1A19_ARATH (1-aminocyclopropane-1-carboxylate synthase 9 OS=Arabidopsis thaliana OX=3702 GN=ACS9 PE=1 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 1.6e-12 Identity = 30/49 (61.22%), Postives = 42/49 (85.71%), Query Frame = 0
BLAST of MELO3C024892.2 vs. Swiss-Prot
Match: sp|Q37001|1A15_ARATH (1-aminocyclopropane-1-carboxylate synthase 5 OS=Arabidopsis thaliana OX=3702 GN=ACS5 PE=1 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 2.1e-12 Identity = 30/49 (61.22%), Postives = 41/49 (83.67%), Query Frame = 0
BLAST of MELO3C024892.2 vs. TrEMBL
Match: tr|A0A1S4DVP5|A0A1S4DVP5_CUCME (1-aminocyclopropane-1-carboxylate synthase CMA101-like isoform X2 OS=Cucumis melo OX=3656 GN=LOC103488536 PE=4 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 6.0e-17 Identity = 44/49 (89.80%), Postives = 47/49 (95.92%), Query Frame = 0
BLAST of MELO3C024892.2 vs. TrEMBL
Match: tr|A0A1S3BD08|A0A1S3BD08_CUCME (1-aminocyclopropane-1-carboxylate synthase CMA101-like isoform X1 OS=Cucumis melo OX=3656 GN=LOC103488536 PE=4 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 6.0e-17 Identity = 44/49 (89.80%), Postives = 47/49 (95.92%), Query Frame = 0
BLAST of MELO3C024892.2 vs. TrEMBL
Match: tr|A0A0S2C3P7|A0A0S2C3P7_CUCME (ACS11 OS=Cucumis melo OX=3656 PE=4 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 6.0e-17 Identity = 44/49 (89.80%), Postives = 47/49 (95.92%), Query Frame = 0
BLAST of MELO3C024892.2 vs. TrEMBL
Match: tr|A0A0A0LKW1|A0A0A0LKW1_CUCSA (ACS11 OS=Cucumis sativus OX=3659 GN=Csa_2G353460 PE=4 SV=1) HSP 1 Score: 93.2 bits (230), Expect = 1.7e-16 Identity = 44/49 (89.80%), Postives = 46/49 (93.88%), Query Frame = 0
BLAST of MELO3C024892.2 vs. TrEMBL
Match: tr|A0A1Q3AQI6|A0A1Q3AQI6_CEPFO (Aminotran_1_2 domain-containing protein (Fragment) OS=Cephalotus follicularis OX=3775 GN=CFOL_v3_01537 PE=4 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 3.1e-13 Identity = 38/47 (80.85%), Postives = 42/47 (89.36%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|