MELO3C024855 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTGGAAGCACAGGAGAACATTCTTTTGTTGATATTATCACCAGTATTCGATATTGGGTCATTCATAGCATTACTATACCTTCTCCATTCATTGCAGGTTGGTTATTCGTCAGCACGGGTTTAGCTTACGATGTTTTTGGAAGCCCTCGTCCAAATGAGTATTATACAGAGAGTCGACAAGGAATTCCATTAATAACTGGCCGTTTTGATTCTTTGGAACAACTCGATGAATTTAGTAGGTCTTTTTAG ATGTCTGGAAGCACAGGAGAACATTCTTTTGTTGATATTATCACCAGTATTCGATATTGGGTCATTCATAGCATTACTATACCTTCTCCATTCATTGCAGGTTGGTTATTCGTCAGCACGGGTTTAGCTTACGATGTTTTTGGAAGCCCTCGTCCAAATGAGTATTATACAGAGAGTCGACAAGGAATTCCATTAATAACTGGCCGTTTTGATTCTTTGGAACAACTCGATGAATTTAGTAGGTCTTTTTAG ATGTCTGGAAGCACAGGAGAACATTCTTTTGTTGATATTATCACCAGTATTCGATATTGGGTCATTCATAGCATTACTATACCTTCTCCATTCATTGCAGGTTGGTTATTCGTCAGCACGGGTTTAGCTTACGATGTTTTTGGAAGCCCTCGTCCAAATGAGTATTATACAGAGAGTCGACAAGGAATTCCATTAATAACTGGCCGTTTTGATTCTTTGGAACAACTCGATGAATTTAGTAGGTCTTTTTAG MSGSTGEHSFVDIITSIRYWVIHSITIPSPFIAGWLFVSTGLAYDVFGSPRPNEYYTESRQGIPLITGRFDSLEQLDEFSRSF*
BLAST of MELO3C024855 vs. Swiss-Prot
Match: PSBE_OENEH (Cytochrome b559 subunit alpha OS=Oenothera elata subsp. hookeri GN=psbE PE=3 SV=4) HSP 1 Score: 163.3 bits (412), Expect = 1.1e-39 Identity = 79/83 (95.18%), Postives = 78/83 (93.98%), Query Frame = 1
BLAST of MELO3C024855 vs. Swiss-Prot
Match: PSBE_GOSBA (Cytochrome b559 subunit alpha OS=Gossypium barbadense GN=psbE PE=3 SV=1) HSP 1 Score: 163.3 bits (412), Expect = 1.1e-39 Identity = 79/83 (95.18%), Postives = 78/83 (93.98%), Query Frame = 1
BLAST of MELO3C024855 vs. Swiss-Prot
Match: PSBE_GOSHI (Cytochrome b559 subunit alpha OS=Gossypium hirsutum GN=psbE PE=3 SV=1) HSP 1 Score: 163.3 bits (412), Expect = 1.1e-39 Identity = 79/83 (95.18%), Postives = 78/83 (93.98%), Query Frame = 1
BLAST of MELO3C024855 vs. Swiss-Prot
Match: PSBE_AMBTC (Cytochrome b559 subunit alpha OS=Amborella trichopoda GN=psbE PE=3 SV=3) HSP 1 Score: 163.3 bits (412), Expect = 1.1e-39 Identity = 79/83 (95.18%), Postives = 78/83 (93.98%), Query Frame = 1
BLAST of MELO3C024855 vs. Swiss-Prot
Match: PSBE_SPIOL (Cytochrome b559 subunit alpha OS=Spinacia oleracea GN=psbE PE=1 SV=2) HSP 1 Score: 163.3 bits (412), Expect = 1.1e-39 Identity = 79/83 (95.18%), Postives = 78/83 (93.98%), Query Frame = 1
BLAST of MELO3C024855 vs. TrEMBL
Match: H2FA99_ALLFI (Cytochrome b559 subunit alpha OS=Allium fistulosum GN=psbE PE=3 SV=1) HSP 1 Score: 164.9 bits (416), Expect = 4.4e-38 Identity = 80/83 (96.39%), Postives = 81/83 (97.59%), Query Frame = 1
BLAST of MELO3C024855 vs. TrEMBL
Match: H2FAA0_ALLCE (Cytochrome b559 subunit alpha OS=Allium cepa GN=psbE PE=3 SV=1) HSP 1 Score: 164.9 bits (416), Expect = 4.4e-38 Identity = 80/83 (96.39%), Postives = 81/83 (97.59%), Query Frame = 1
BLAST of MELO3C024855 vs. TrEMBL
Match: A9L9B3_LEMMI (Cytochrome b559 subunit alpha OS=Lemna minor GN=psbE PE=3 SV=1) HSP 1 Score: 163.7 bits (413), Expect = 9.7e-38 Identity = 79/83 (95.18%), Postives = 81/83 (97.59%), Query Frame = 1
BLAST of MELO3C024855 vs. TrEMBL
Match: A0A0S2IDT5_9ROSI (Cytochrome b559 subunit alpha OS=Cucurbita argyrosperma var. palmeri GN=psbE PE=3 SV=1) HSP 1 Score: 163.3 bits (412), Expect = 1.3e-37 Identity = 79/83 (95.18%), Postives = 80/83 (96.39%), Query Frame = 1
BLAST of MELO3C024855 vs. TrEMBL
Match: A0A0G2QY13_9CARY (Cytochrome b559 subunit alpha OS=Salicornia brachiata GN=psbE PE=3 SV=1) HSP 1 Score: 163.3 bits (412), Expect = 1.3e-37 Identity = 79/83 (95.18%), Postives = 80/83 (96.39%), Query Frame = 1
BLAST of MELO3C024855 vs. TAIR10
Match: ATCG00580.1 (ATCG00580.1 photosystem II reaction center protein E) HSP 1 Score: 161.4 bits (407), Expect = 2.4e-40 Identity = 78/83 (93.98%), Postives = 77/83 (92.77%), Query Frame = 1
BLAST of MELO3C024855 vs. NCBI nr
Match: gi|695101519|ref|YP_009057168.1| (photosystem II cytochrome b559 alpha subunit (chloroplast) [Allium cepa]) HSP 1 Score: 164.9 bits (416), Expect = 6.3e-38 Identity = 80/83 (96.39%), Postives = 81/83 (97.59%), Query Frame = 1
BLAST of MELO3C024855 vs. NCBI nr
Match: gi|161784209|ref|YP_001595525.1| (PSII reaction center subunit V [Lemna minor]) HSP 1 Score: 163.7 bits (413), Expect = 1.4e-37 Identity = 79/83 (95.18%), Postives = 81/83 (97.59%), Query Frame = 1
BLAST of MELO3C024855 vs. NCBI nr
Match: gi|641277058|emb|CDP54793.1| (Cytochrome b559 alpha chain (PsbE) [Staphylococcus aureus subsp. aureus]) HSP 1 Score: 163.3 bits (412), Expect = 1.8e-37 Identity = 79/83 (95.18%), Postives = 80/83 (96.39%), Query Frame = 1
BLAST of MELO3C024855 vs. NCBI nr
Match: gi|7514666|pir||T14570 (cytochrome b559 component psbE - beet chloroplast) HSP 1 Score: 163.3 bits (412), Expect = 1.8e-37 Identity = 79/83 (95.18%), Postives = 80/83 (96.39%), Query Frame = 1
BLAST of MELO3C024855 vs. NCBI nr
Match: gi|757609032|ref|WP_042854921.1| (cytochrome b559 subunit alpha [Staphylococcus aureus]) HSP 1 Score: 163.3 bits (412), Expect = 1.8e-37 Identity = 79/83 (95.18%), Postives = 80/83 (96.39%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|