MELO3C024467 (gene) Melon (DHL92) v3.5.1

NameMELO3C024467
Typegene
OrganismCucumis melo (Melon (DHL92) v3.5.1)
DescriptionBifunctional uridylyltransferase/uridylyl-removing enzyme
Locationchr8 : 9117814 .. 9118237 (-)
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGCTCACTCCTCCCATTGCCGCCCAGCCAGTCCGACTCCGTTGGCGTCAACCGACCCACCAGCCCTCCTTTCTCAACGCTAAGTCTCAATCGTTCTTTCCCATTCCCTCTCTCCATTTCTCTCACTCATGGCCACCCAACCGTAGCAAACGCCAGACTTTCGCCCAACTCCGCCGCCGTCCCTGTCTCCGCAGGCCACGACCACCGCACGCCGTCTTCGTATATCCGCCTTTGGTTGGTTATGATTCCCTTCCCTTCTCGTTTATCCTTCTCTCTCTATTTAACTCTCGATCTCTCTATCTCCATCTTCTTGTTCCAGCCCTATCCGCCACAGCCCAGAATCGCCGCTGACGTTCTTCAAGCTCGTCGCTGCCGCGGTAACTTCTCGTCGATCGCCGGCGCTGTTTGTTCTCGTACTAGTTAA

mRNA sequence

ATGCTCACTCCTCCCATTGCCGCCCAGCCAGTCCGACTCCGTTGGCGTCAACCGACCCACCAGCCCTCCTTTCTCAACGCTAAGTCTCAATCGTTCTTTCCCATTCCCTCTCTCCATTTCTCTCACTCATGGCCACCCAACCGTAGCAAACGCCAGACTTTCGCCCAACTCCGCCGCCGTCCCTGTCTCCGCAGGCCACGACCACCGCACGCCGTCTTCGTATATCCGCCTTTGCCCTATCCGCCACAGCCCAGAATCGCCGCTGACGTTCTTCAAGCTCGTCGCTGCCGCGGTAACTTCTCGTCGATCGCCGGCGCTGTTTGTTCTCGTACTAGTTAA

Coding sequence (CDS)

ATGCTCACTCCTCCCATTGCCGCCCAGCCAGTCCGACTCCGTTGGCGTCAACCGACCCACCAGCCCTCCTTTCTCAACGCTAAGTCTCAATCGTTCTTTCCCATTCCCTCTCTCCATTTCTCTCACTCATGGCCACCCAACCGTAGCAAACGCCAGACTTTCGCCCAACTCCGCCGCCGTCCCTGTCTCCGCAGGCCACGACCACCGCACGCCGTCTTCGTATATCCGCCTTTGCCCTATCCGCCACAGCCCAGAATCGCCGCTGACGTTCTTCAAGCTCGTCGCTGCCGCGGTAACTTCTCGTCGATCGCCGGCGCTGTTTGTTCTCGTACTAGTTAA

Protein sequence

MLTPPIAAQPVRLRWRQPTHQPSFLNAKSQSFFPIPSLHFSHSWPPNRSKRQTFAQLRRRPCLRRPRPPHAVFVYPPLPYPPQPRIAADVLQARRCRGNFSSIAGAVCSRTS*
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0008150 biological_process
biological_process GO:0045454 cell redox homeostasis
biological_process GO:0006662 glycerol ether metabolic process
cellular_component GO:0005575 cellular_component
molecular_function GO:0003674 molecular_function
molecular_function GO:0015035 protein disulfide oxidoreductase activity
This gene is associated with the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
MU47998melon EST collection version 4.0transcribed_cluster

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
MELO3C024467T1MELO3C024467T1mRNA


The following transcribed_cluster feature(s) are associated with this gene:

Feature NameUnique NameType
MU47998MU47998transcribed_cluster


The following gene(s) are orthologous to this gene:

None

The following gene(s) are paralogous to this gene:

None

The following block(s) are covering this gene:
GeneOrganismBlock
MELO3C024467Watermelon (97103) v2mewmbB518
MELO3C024467Watermelon (97103) v2mewmbB528
MELO3C024467Watermelon (97103) v2mewmbB539
MELO3C024467Wax gourdmewgoB614
MELO3C024467Wax gourdmewgoB629
MELO3C024467Wax gourdmewgoB639
MELO3C024467Melon (DHL92) v3.5.1memeB142
MELO3C024467Cucumber (Gy14) v1cgymeB194
MELO3C024467Cucumber (Gy14) v1cgymeB507
MELO3C024467Cucumber (Gy14) v1cgymeB633
MELO3C024467Cucurbita maxima (Rimu)cmameB248
MELO3C024467Cucurbita maxima (Rimu)cmameB609
MELO3C024467Cucurbita maxima (Rimu)cmameB799
MELO3C024467Cucurbita moschata (Rifu)cmomeB236
MELO3C024467Cucurbita moschata (Rifu)cmomeB598
MELO3C024467Cucurbita moschata (Rifu)cmomeB763
MELO3C024467Cucurbita moschata (Rifu)cmomeB783
MELO3C024467Wild cucumber (PI 183967)cpimeB257
MELO3C024467Wild cucumber (PI 183967)cpimeB513
MELO3C024467Wild cucumber (PI 183967)cpimeB515
MELO3C024467Cucumber (Chinese Long) v2cumeB261
MELO3C024467Cucumber (Chinese Long) v2cumeB508
MELO3C024467Cucumber (Chinese Long) v2cumeB509
MELO3C024467Watermelon (Charleston Gray)mewcgB507
MELO3C024467Watermelon (Charleston Gray)mewcgB522
MELO3C024467Watermelon (Charleston Gray)mewcgB531
MELO3C024467Watermelon (97103) v1mewmB553
MELO3C024467Watermelon (97103) v1mewmB584
MELO3C024467Cucurbita pepo (Zucchini)cpemeB069
MELO3C024467Cucurbita pepo (Zucchini)cpemeB458
MELO3C024467Cucurbita pepo (Zucchini)cpemeB592
MELO3C024467Bottle gourd (USVL1VR-Ls)lsimeB150
MELO3C024467Bottle gourd (USVL1VR-Ls)lsimeB274
MELO3C024467Cucumber (Gy14) v2cgybmeB223
MELO3C024467Cucumber (Gy14) v2cgybmeB448
MELO3C024467Cucumber (Gy14) v2cgybmeB446
MELO3C024467Silver-seed gourdcarmeB0242
MELO3C024467Silver-seed gourdcarmeB0253
MELO3C024467Silver-seed gourdcarmeB0654
MELO3C024467Cucumber (Chinese Long) v3cucmeB261
MELO3C024467Cucumber (Chinese Long) v3cucmeB521
MELO3C024467Cucumber (Chinese Long) v3cucmeB523