MELO3C024219 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCACTTTTTTTATTGGAACGTCTCCTAGCATTTGATCCCAAATGTCGTCTAACAGCTGCAGAGGTGAGTCAAATCTACCAACTTGTTTTATTAACCTAATATCATGCCTTTATAATATATTCATTCAATTTCAGGCCCTTGCTGATCCTTACTTCAACGGTATGGCGAAACAAGAACTTGAACCTTCTATTCAACCAATTTCAAAACTTGAGTTTGAGTTTGAAAGGAGGAAGTTATCAAAAGATGATGTTAGAGAGTTGATTTATGCAGAGGTAATATAA ATGGCACTTTTTTTATTGGAACGTCTCCTAGCATTTGATCCCAAATGTCGTCTAACAGCTGCAGAGGCCCTTGCTGATCCTTACTTCAACGGTATGGCGAAACAAGAACTTGAACCTTCTATTCAACCAATTTCAAAACTTGAGTTTGAGTTTGAAAGGAGGAAGTTATCAAAAGATGATGTTAGAGAGTTGATTTATGCAGAGGTAATATAA ATGGCACTTTTTTTATTGGAACGTCTCCTAGCATTTGATCCCAAATGTCGTCTAACAGCTGCAGAGGCCCTTGCTGATCCTTACTTCAACGGTATGGCGAAACAAGAACTTGAACCTTCTATTCAACCAATTTCAAAACTTGAGTTTGAGTTTGAAAGGAGGAAGTTATCAAAAGATGATGTTAGAGAGTTGATTTATGCAGAGGTAATATAA MALFLLERLLAFDPKCRLTAAEALADPYFNGMAKQELEPSIQPISKLEFEFERRKLSKDDVRELIYAEVI*
BLAST of MELO3C024219 vs. Swiss-Prot
Match: MPK16_ORYSJ (Mitogen-activated protein kinase 16 OS=Oryza sativa subsp. japonica GN=MPK16 PE=2 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 1.7e-23 Identity = 55/70 (78.57%), Postives = 57/70 (81.43%), Query Frame = 1
BLAST of MELO3C024219 vs. Swiss-Prot
Match: MPK17_ORYSJ (Mitogen-activated protein kinase 17 OS=Oryza sativa subsp. japonica GN=MPK17 PE=2 SV=2) HSP 1 Score: 107.1 bits (266), Expect = 8.2e-23 Identity = 53/70 (75.71%), Postives = 57/70 (81.43%), Query Frame = 1
BLAST of MELO3C024219 vs. Swiss-Prot
Match: MPK19_ARATH (Mitogen-activated protein kinase 19 OS=Arabidopsis thaliana GN=MPK19 PE=2 SV=2) HSP 1 Score: 105.5 bits (262), Expect = 2.4e-22 Identity = 52/70 (74.29%), Postives = 59/70 (84.29%), Query Frame = 1
BLAST of MELO3C024219 vs. Swiss-Prot
Match: MPK7_ORYSJ (Mitogen-activated protein kinase 7 OS=Oryza sativa subsp. japonica GN=MPK7 PE=2 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 5.3e-22 Identity = 50/70 (71.43%), Postives = 59/70 (84.29%), Query Frame = 1
BLAST of MELO3C024219 vs. Swiss-Prot
Match: MPK15_ARATH (Mitogen-activated protein kinase 15 OS=Arabidopsis thaliana GN=MPK15 PE=1 SV=3) HSP 1 Score: 103.6 bits (257), Expect = 9.1e-22 Identity = 50/69 (72.46%), Postives = 58/69 (84.06%), Query Frame = 1
BLAST of MELO3C024219 vs. TrEMBL
Match: A0A0A0LQG7_CUCSA (Mitogen-activated protein kinase OS=Cucumis sativus GN=Csa_1G042720 PE=4 SV=1) HSP 1 Score: 131.0 bits (328), Expect = 5.9e-28 Identity = 65/70 (92.86%), Postives = 67/70 (95.71%), Query Frame = 1
BLAST of MELO3C024219 vs. TrEMBL
Match: B4F907_MAIZE (Mitogen-activated protein kinase OS=Zea mays PE=2 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 1.1e-21 Identity = 55/70 (78.57%), Postives = 61/70 (87.14%), Query Frame = 1
BLAST of MELO3C024219 vs. TrEMBL
Match: A0A096QVT1_MAIZE (Mitogen-activated protein kinase OS=Zea mays GN=cl4121_1 PE=4 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 1.1e-21 Identity = 55/70 (78.57%), Postives = 61/70 (87.14%), Query Frame = 1
BLAST of MELO3C024219 vs. TrEMBL
Match: A0A0D9YCC2_9ORYZ (Mitogen-activated protein kinase OS=Oryza glumipatula PE=4 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 1.8e-21 Identity = 55/70 (78.57%), Postives = 59/70 (84.29%), Query Frame = 1
BLAST of MELO3C024219 vs. TrEMBL
Match: M0Y996_HORVD (Uncharacterized protein OS=Hordeum vulgare var. distichum PE=4 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 1.8e-21 Identity = 54/70 (77.14%), Postives = 61/70 (87.14%), Query Frame = 1
BLAST of MELO3C024219 vs. TAIR10
Match: AT3G14720.1 (AT3G14720.1 MAP kinase 19) HSP 1 Score: 105.5 bits (262), Expect = 1.3e-23 Identity = 52/70 (74.29%), Postives = 59/70 (84.29%), Query Frame = 1
BLAST of MELO3C024219 vs. TAIR10
Match: AT1G73670.1 (AT1G73670.1 MAP kinase 15) HSP 1 Score: 103.6 bits (257), Expect = 5.1e-23 Identity = 50/69 (72.46%), Postives = 58/69 (84.06%), Query Frame = 1
BLAST of MELO3C024219 vs. TAIR10
Match: AT1G18150.2 (AT1G18150.2 Protein kinase superfamily protein) HSP 1 Score: 102.1 bits (253), Expect = 1.5e-22 Identity = 49/70 (70.00%), Postives = 58/70 (82.86%), Query Frame = 1
BLAST of MELO3C024219 vs. TAIR10
Match: AT1G53510.1 (AT1G53510.1 mitogen-activated protein kinase 18) HSP 1 Score: 102.1 bits (253), Expect = 1.5e-22 Identity = 50/70 (71.43%), Postives = 58/70 (82.86%), Query Frame = 1
BLAST of MELO3C024219 vs. TAIR10
Match: AT2G01450.1 (AT2G01450.1 MAP kinase 17) HSP 1 Score: 100.9 bits (250), Expect = 3.3e-22 Identity = 49/70 (70.00%), Postives = 58/70 (82.86%), Query Frame = 1
BLAST of MELO3C024219 vs. NCBI nr
Match: gi|659124343|ref|XP_008462108.1| (PREDICTED: mitogen-activated protein kinase 9-like [Cucumis melo]) HSP 1 Score: 137.9 bits (346), Expect = 6.9e-30 Identity = 68/70 (97.14%), Postives = 70/70 (100.00%), Query Frame = 1
BLAST of MELO3C024219 vs. NCBI nr
Match: gi|659066829|ref|XP_008463306.1| (PREDICTED: mitogen-activated protein kinase 9-like isoform X2 [Cucumis melo]) HSP 1 Score: 132.5 bits (332), Expect = 2.9e-28 Identity = 66/70 (94.29%), Postives = 68/70 (97.14%), Query Frame = 1
BLAST of MELO3C024219 vs. NCBI nr
Match: gi|659066825|ref|XP_008463177.1| (PREDICTED: mitogen-activated protein kinase 9-like isoform X1 [Cucumis melo]) HSP 1 Score: 132.5 bits (332), Expect = 2.9e-28 Identity = 66/70 (94.29%), Postives = 68/70 (97.14%), Query Frame = 1
BLAST of MELO3C024219 vs. NCBI nr
Match: gi|659066831|ref|XP_008463378.1| (PREDICTED: mitogen-activated protein kinase 9-like isoform X3 [Cucumis melo]) HSP 1 Score: 132.5 bits (332), Expect = 2.9e-28 Identity = 66/70 (94.29%), Postives = 68/70 (97.14%), Query Frame = 1
BLAST of MELO3C024219 vs. NCBI nr
Match: gi|778657344|ref|XP_011650742.1| (PREDICTED: mitogen-activated protein kinase 9-like isoform X2 [Cucumis sativus]) HSP 1 Score: 131.0 bits (328), Expect = 8.5e-28 Identity = 65/70 (92.86%), Postives = 67/70 (95.71%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |