MELO3C023756 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAAACGACTTCCAATTTCTCTCTAATTCTAAGTTATATGCGGGGGGCTTGGATGGTGAGCAAAAAGAGTTGATCAAGAAGTTGGTCGACTTTTGCATGAAAAAAGGTAAAAGAACAAGAGTTCATGCTATTGTTTATCAAACTTTGAATCACCAAGCTCAAACTAAACGAGATGGAATCAAATTCATGGTTGAGGTCCCAGAGAATATAAAGACCATATGTGAAGTCAAAAAGGTAGGAGTAGCAGGTACTATTTATGATATCCCTGGGATTGTAGCTAGGGATCGTCAACAAACCTTTGCTATTCATTGGATCCTTGAAGCAGCTTTCAAATGA ATGGAAAACGACTTCCAATTTCTCTCTAATTCTAAGTTATATGCGGGGGGCTTGGATGGTGAGCAAAAAGAGTTGATCAAGAAGTTGGTCGACTTTTGCATGAAAAAAGGTAAAAGAACAAGAGTTCATGCTATTGTTTATCAAACTTTGAATCACCAAGCTCAAACTAAACGAGATGGAATCAAATTCATGGTTGAGGTCCCAGAGAATATAAAGACCATATGTGAAGTCAAAAAGGTAGGAGTAGCAGGTACTATTTATGATATCCCTGGGATTGTAGCTAGGGATCGTCAACAAACCTTTGCTATTCATTGGATCCTTGAAGCAGCTTTCAAATGA ATGGAAAACGACTTCCAATTTCTCTCTAATTCTAAGTTATATGCGGGGGGCTTGGATGGTGAGCAAAAAGAGTTGATCAAGAAGTTGGTCGACTTTTGCATGAAAAAAGGTAAAAGAACAAGAGTTCATGCTATTGTTTATCAAACTTTGAATCACCAAGCTCAAACTAAACGAGATGGAATCAAATTCATGGTTGAGGTCCCAGAGAATATAAAGACCATATGTGAAGTCAAAAAGGTAGGAGTAGCAGGTACTATTTATGATATCCCTGGGATTGTAGCTAGGGATCGTCAACAAACCTTTGCTATTCATTGGATCCTTGAAGCAGCTTTCAAATGA MENDFQFLSNSKLYAGGLDGEQKELIKKLVDFCMKKGKRTRVHAIVYQTLNHQAQTKRDGIKFMVEVPENIKTICEVKKVGVAGTIYDIPGIVARDRQQTFAIHWILEAAFK*
BLAST of MELO3C023756 vs. Swiss-Prot
Match: RT07_ARATH (Ribosomal protein S7, mitochondrial OS=Arabidopsis thaliana GN=RPS7 PE=2 SV=1) HSP 1 Score: 150.2 bits (378), Expect = 1.3e-35 Identity = 76/97 (78.35%), Postives = 81/97 (83.51%), Query Frame = 1
BLAST of MELO3C023756 vs. Swiss-Prot
Match: RT07_BETVU (Ribosomal protein S7, mitochondrial OS=Beta vulgaris GN=RPS7 PE=2 SV=2) HSP 1 Score: 141.4 bits (355), Expect = 6.3e-33 Identity = 70/97 (72.16%), Postives = 80/97 (82.47%), Query Frame = 1
BLAST of MELO3C023756 vs. Swiss-Prot
Match: RT07_WHEAT (Ribosomal protein S7, mitochondrial OS=Triticum aestivum GN=RPS7 PE=3 SV=1) HSP 1 Score: 139.0 bits (349), Expect = 3.1e-32 Identity = 71/97 (73.20%), Postives = 77/97 (79.38%), Query Frame = 1
BLAST of MELO3C023756 vs. Swiss-Prot
Match: RT07_MARPO (Ribosomal protein S7, mitochondrial OS=Marchantia polymorpha GN=RPS7 PE=3 SV=2) HSP 1 Score: 103.2 bits (256), Expect = 1.9e-21 Identity = 53/99 (53.54%), Postives = 67/99 (67.68%), Query Frame = 1
BLAST of MELO3C023756 vs. Swiss-Prot
Match: RS7_HALHL (30S ribosomal protein S7 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rpsG PE=3 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 1.1e-08 Identity = 34/89 (38.20%), Postives = 44/89 (49.44%), Query Frame = 1
BLAST of MELO3C023756 vs. TrEMBL
Match: G3EU25_CUCME (Ribosomal protein S7 OS=Cucumis melo subsp. melo GN=rps7 PE=4 SV=1) HSP 1 Score: 161.0 bits (406), Expect = 8.5e-37 Identity = 81/97 (83.51%), Postives = 86/97 (88.66%), Query Frame = 1
BLAST of MELO3C023756 vs. TrEMBL
Match: G3EIX5_CUCSA (Ribosomal protein S7 OS=Cucumis sativus GN=rps7 PE=4 SV=1) HSP 1 Score: 155.6 bits (392), Expect = 3.6e-35 Identity = 78/97 (80.41%), Postives = 84/97 (86.60%), Query Frame = 1
BLAST of MELO3C023756 vs. TrEMBL
Match: A0A0M4R6T5_CANSA (Ribosomal protein S7 OS=Cannabis sativa GN=rps7 PE=4 SV=1) HSP 1 Score: 154.5 bits (389), Expect = 7.9e-35 Identity = 77/97 (79.38%), Postives = 85/97 (87.63%), Query Frame = 1
BLAST of MELO3C023756 vs. TrEMBL
Match: A0A142BZ01_ZIZJJ (Ribosomal protein S7 OS=Ziziphus jujuba GN=rps7 PE=4 SV=1) HSP 1 Score: 154.5 bits (389), Expect = 7.9e-35 Identity = 77/97 (79.38%), Postives = 85/97 (87.63%), Query Frame = 1
BLAST of MELO3C023756 vs. TrEMBL
Match: D5I3C7_CITLA (Ribosomal protein S7 OS=Citrullus lanatus GN=rps7 PE=4 SV=1) HSP 1 Score: 154.1 bits (388), Expect = 1.0e-34 Identity = 77/97 (79.38%), Postives = 85/97 (87.63%), Query Frame = 1
BLAST of MELO3C023756 vs. TAIR10
Match: AT2G07696.1 (AT2G07696.1 Ribosomal protein S7p/S5e family protein) HSP 1 Score: 150.2 bits (378), Expect = 7.6e-37 Identity = 76/97 (78.35%), Postives = 81/97 (83.51%), Query Frame = 1
BLAST of MELO3C023756 vs. TAIR10
Match: ATMG01270.1 (ATMG01270.1 mitochondrial ribosomal protein S7) HSP 1 Score: 150.2 bits (378), Expect = 7.6e-37 Identity = 76/97 (78.35%), Postives = 81/97 (83.51%), Query Frame = 1
BLAST of MELO3C023756 vs. NCBI nr
Match: gi|345034423|gb|AEN56109.1| (ribosomal protein S7 [Cucumis melo subsp. melo]) HSP 1 Score: 161.0 bits (406), Expect = 1.2e-36 Identity = 81/97 (83.51%), Postives = 86/97 (88.66%), Query Frame = 1
BLAST of MELO3C023756 vs. NCBI nr
Match: gi|346683361|ref|YP_004849323.1| (ribosomal protein S7 [Cucumis sativus]) HSP 1 Score: 155.6 bits (392), Expect = 5.1e-35 Identity = 78/97 (80.41%), Postives = 84/97 (86.60%), Query Frame = 1
BLAST of MELO3C023756 vs. NCBI nr
Match: gi|1016880331|ref|YP_009243658.1| (ribosomal protein S7 (mitochondrion) [Cannabis sativa]) HSP 1 Score: 154.5 bits (389), Expect = 1.1e-34 Identity = 77/97 (79.38%), Postives = 85/97 (87.63%), Query Frame = 1
BLAST of MELO3C023756 vs. NCBI nr
Match: gi|1016470801|ref|YP_009241662.1| (ribosomal protein S7 (mitochondrion) [Ziziphus jujuba]) HSP 1 Score: 154.5 bits (389), Expect = 1.1e-34 Identity = 77/97 (79.38%), Postives = 85/97 (87.63%), Query Frame = 1
BLAST of MELO3C023756 vs. NCBI nr
Match: gi|295311664|ref|YP_003587257.1| (ribosomal protein S7 [Citrullus lanatus]) HSP 1 Score: 154.1 bits (388), Expect = 1.5e-34 Identity = 77/97 (79.38%), Postives = 85/97 (87.63%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|