MELO3C023356 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGGCGGGGGGAATTCAGTCGGCGACGGATAAGGAATTGGTGACACTTTGTTCAAAGTTTTTGAACGGCGGGAGGGACACGACGGAGACAGTGATAGAGTGGGGGATGGCAGAATTGATAGCGAATAAGGAAGTTCAAAGGAAGATTGTGGAAGAAATTAAAGAGACGGTTGGTGAGAGAAAAGTAGAG ATGGCGGCGGGGGGAATTCAGTCGGCGACGGATAAGGAATTGGTGACACTTTGTTCAAAGTTTTTGAACGGCGGGAGGGACACGACGGAGACAGTGATAGAGTGGGGGATGGCAGAATTGATAGCGAATAAGGAAGTTCAAAGGAAGATTGTGGAAGAAATTAAAGAGACGGTTGGTGAGAGAAAAGTAGAG ATGGCGGCGGGGGGAATTCAGTCGGCGACGGATAAGGAATTGGTGACACTTTGTTCAAAGTTTTTGAACGGCGGGAGGGACACGACGGAGACAGTGATAGAGTGGGGGATGGCAGAATTGATAGCGAATAAGGAAGTTCAAAGGAAGATTGTGGAAGAAATTAAAGAGACGGTTGGTGAGAGAAAAGTAGAG MAAGGIQSATDKELVTLCSKFLNGGRDTTETVIEWGMAELIANKEVQRKIVEEIKETVGERKVE
BLAST of MELO3C023356 vs. Swiss-Prot
Match: C77A3_SOYBN (Cytochrome P450 77A3 OS=Glycine max GN=CYP77A3 PE=2 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 2.5e-15 Identity = 38/61 (62.30%), Postives = 46/61 (75.41%), Query Frame = 1
BLAST of MELO3C023356 vs. Swiss-Prot
Match: C77A4_ARATH (Cytochrome P450 77A4 OS=Arabidopsis thaliana GN=CYP77A4 PE=2 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 2.4e-13 Identity = 35/56 (62.50%), Postives = 46/56 (82.14%), Query Frame = 1
BLAST of MELO3C023356 vs. Swiss-Prot
Match: C77A2_SOLME (Cytochrome P450 77A2 OS=Solanum melongena GN=CYP77A2 PE=2 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 1.5e-12 Identity = 34/61 (55.74%), Postives = 41/61 (67.21%), Query Frame = 1
BLAST of MELO3C023356 vs. Swiss-Prot
Match: C77A1_SOLME (Cytochrome P450 77A1 (Fragment) OS=Solanum melongena GN=CYP77A1 PE=2 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 1.0e-11 Identity = 30/55 (54.55%), Postives = 40/55 (72.73%), Query Frame = 1
BLAST of MELO3C023356 vs. Swiss-Prot
Match: C89A2_ARATH (Cytochrome P450 89A2 OS=Arabidopsis thaliana GN=CYP89A2 PE=2 SV=2) HSP 1 Score: 56.2 bits (134), Expect = 1.5e-07 Identity = 24/54 (44.44%), Postives = 34/54 (62.96%), Query Frame = 1
BLAST of MELO3C023356 vs. TrEMBL
Match: A0A0A0KWN5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G615280 PE=3 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 2.4e-20 Identity = 52/61 (85.25%), Postives = 56/61 (91.80%), Query Frame = 1
BLAST of MELO3C023356 vs. TrEMBL
Match: A0A0A0K9C6_CUCSA (Cytochrome P450 77A3 OS=Cucumis sativus GN=Csa_6G044530 PE=3 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 7.5e-14 Identity = 40/61 (65.57%), Postives = 48/61 (78.69%), Query Frame = 1
BLAST of MELO3C023356 vs. TrEMBL
Match: A0A0L9TZ26_PHAAN (Uncharacterized protein OS=Phaseolus angularis GN=LR48_Vigan02g180200 PE=3 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 7.5e-14 Identity = 39/61 (63.93%), Postives = 49/61 (80.33%), Query Frame = 1
BLAST of MELO3C023356 vs. TrEMBL
Match: A0A0S3SP59_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis GN=Vigan.08G116800 PE=3 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 7.5e-14 Identity = 39/61 (63.93%), Postives = 49/61 (80.33%), Query Frame = 1
BLAST of MELO3C023356 vs. TrEMBL
Match: V7BDC4_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_007G104800g PE=3 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 9.8e-14 Identity = 39/61 (63.93%), Postives = 48/61 (78.69%), Query Frame = 1
BLAST of MELO3C023356 vs. TAIR10
Match: AT3G10570.1 (AT3G10570.1 cytochrome P450, family 77, subfamily A, polypeptide 6) HSP 1 Score: 80.5 bits (197), Expect = 4.2e-16 Identity = 36/61 (59.02%), Postives = 48/61 (78.69%), Query Frame = 1
BLAST of MELO3C023356 vs. TAIR10
Match: AT3G10560.1 (AT3G10560.1 Cytochrome P450 superfamily protein) HSP 1 Score: 77.4 bits (189), Expect = 3.5e-15 Identity = 35/61 (57.38%), Postives = 45/61 (73.77%), Query Frame = 1
BLAST of MELO3C023356 vs. TAIR10
Match: AT5G04660.1 (AT5G04660.1 cytochrome P450, family 77, subfamily A, polypeptide 4) HSP 1 Score: 75.5 bits (184), Expect = 1.3e-14 Identity = 35/56 (62.50%), Postives = 46/56 (82.14%), Query Frame = 1
BLAST of MELO3C023356 vs. TAIR10
Match: AT5G04630.1 (AT5G04630.1 cytochrome P450, family 77, subfamily A, polypeptide 9) HSP 1 Score: 73.6 bits (179), Expect = 5.1e-14 Identity = 35/58 (60.34%), Postives = 45/58 (77.59%), Query Frame = 1
BLAST of MELO3C023356 vs. TAIR10
Match: AT2G12190.1 (AT2G12190.1 Cytochrome P450 superfamily protein) HSP 1 Score: 67.4 bits (163), Expect = 3.7e-12 Identity = 29/54 (53.70%), Postives = 39/54 (72.22%), Query Frame = 1
BLAST of MELO3C023356 vs. NCBI nr
Match: gi|659091872|ref|XP_008446777.1| (PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 77A3-like [Cucumis melo]) HSP 1 Score: 107.1 bits (266), Expect = 1.2e-20 Identity = 52/63 (82.54%), Postives = 58/63 (92.06%), Query Frame = 1
BLAST of MELO3C023356 vs. NCBI nr
Match: gi|778706383|ref|XP_011655840.1| (PREDICTED: cytochrome P450 77A3-like [Cucumis sativus]) HSP 1 Score: 105.5 bits (262), Expect = 3.4e-20 Identity = 52/61 (85.25%), Postives = 56/61 (91.80%), Query Frame = 1
BLAST of MELO3C023356 vs. NCBI nr
Match: gi|1021480512|ref|XP_016183427.1| (PREDICTED: cytochrome P450 77A3-like [Arachis ipaensis]) HSP 1 Score: 85.1 bits (209), Expect = 4.8e-14 Identity = 40/60 (66.67%), Postives = 48/60 (80.00%), Query Frame = 1
BLAST of MELO3C023356 vs. NCBI nr
Match: gi|965608064|dbj|BAT94555.1| (hypothetical protein VIGAN_08116800 [Vigna angularis var. angularis]) HSP 1 Score: 84.0 bits (206), Expect = 1.1e-13 Identity = 39/61 (63.93%), Postives = 49/61 (80.33%), Query Frame = 1
BLAST of MELO3C023356 vs. NCBI nr
Match: gi|449446271|ref|XP_004140895.1| (PREDICTED: cytochrome P450 77A3-like [Cucumis sativus]) HSP 1 Score: 84.0 bits (206), Expect = 1.1e-13 Identity = 40/61 (65.57%), Postives = 48/61 (78.69%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |