MELO3C023182.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTAAATCTGAGCCTTCGTGTTCTCTCTCATCCTGAGATTTCTCATCTCTCCGATATTTTCAAAACCCTAGGTCTAGAGTATGATGAGAAGATCCTCCTTTCAATTGGAAATGAGGTTCTGAAAGTCGTCGTCGCTTAGTTCAACATCGATCAGCTTTTGACTGAGCAGCCTCAGGTTTTGGTTCCATCTTGTGTGAGGGTTTGGTTCTGAGGGCTAAGGACTTCAACATTATGCTAAATAATGTTGATATCACTCATTTGTCTTATAGCCTAGAGTTCTCCAAGGTAGTTGAGCAGAAGTAAGTAGCTCAACAAGAGGCTAGGAATTCAAAATTTGTTGTGGCTAAGGCTGAACAAGAAAGAAGGGTTGCAATTATTAGGGCTAAAGGTGAGAGCAATTCAGCTAAATTGGTTTATGATGCTACATCATCTACTGGTATGGGTTTGATTGAGCTGAGGAGAATTGAAGCATCAAGGGAGAATGCATGCACCCTCTTAAAGTCGTCGAATGTAGCCTACTTGCTCGGAGGTTAG ATGGTAAATCTGAGCCTTCGTGTTCTCTCTCATCCTGAGATTTCTCATCTCTCCGATATTTTCAAAACCCTAGGTCTAGAGTATGATGAGAAGATCCTCCTTTCAATTGGAAATGAGGCTGAACAAGAAAGAAGGGTTGCAATTATTAGGGCTAAAGGTGAGAGCAATTCAGCTAAATTGGTTTATGATGCTACATCATCTACTGGTATGGGTTTGATTGAGCTGAGGAGAATTGAAGCATCAAGGGAGAATGCATGCACCCTCTTAAAGTCGTCGAATGTAGCCTACTTGCTCGGAGGTTAG ATGGTAAATCTGAGCCTTCGTGTTCTCTCTCATCCTGAGATTTCTCATCTCTCCGATATTTTCAAAACCCTAGGTCTAGAGTATGATGAGAAGATCCTCCTTTCAATTGGAAATGAGGCTGAACAAGAAAGAAGGGTTGCAATTATTAGGGCTAAAGGTGAGAGCAATTCAGCTAAATTGGTTTATGATGCTACATCATCTACTGGTATGGGTTTGATTGAGCTGAGGAGAATTGAAGCATCAAGGGAGAATGCATGCACCCTCTTAAAGTCGTCGAATGTAGCCTACTTGCTCGGAGGTTAG MVNLSLRVLSHPEISHLSDIFKTLGLEYDEKILLSIGNEAEQERRVAIIRAKGESNSAKLVYDATSSTGMGLIELRRIEASRENACTLLKSSNVAYLLGG
BLAST of MELO3C023182.2 vs. NCBI nr
Match: XP_004138106.1 (PREDICTED: prohibitin-3, mitochondrial [Cucumis sativus] >XP_011657013.1 PREDICTED: prohibitin-3, mitochondrial [Cucumis sativus] >XP_011657055.1 PREDICTED: prohibitin-3, mitochondrial [Cucumis sativus] >KGN63578.1 hypothetical protein Csa_1G004910 [Cucumis sativus]) HSP 1 Score: 120.6 bits (301), Expect = 3.1e-24 Identity = 84/177 (47.46%), Postives = 88/177 (49.72%), Query Frame = 0
BLAST of MELO3C023182.2 vs. NCBI nr
Match: XP_008453082.1 (PREDICTED: prohibitin-3, mitochondrial [Cucumis melo] >XP_008453083.1 PREDICTED: prohibitin-3, mitochondrial [Cucumis melo] >XP_008453084.1 PREDICTED: prohibitin-3, mitochondrial [Cucumis melo] >XP_008453085.1 PREDICTED: prohibitin-3, mitochondrial [Cucumis melo]) HSP 1 Score: 120.6 bits (301), Expect = 3.1e-24 Identity = 84/177 (47.46%), Postives = 88/177 (49.72%), Query Frame = 0
BLAST of MELO3C023182.2 vs. NCBI nr
Match: KHN34017.1 (Prohibitin-1 [Glycine soja]) HSP 1 Score: 120.2 bits (300), Expect = 4.1e-24 Identity = 73/131 (55.73%), Postives = 83/131 (63.36%), Query Frame = 0
BLAST of MELO3C023182.2 vs. NCBI nr
Match: XP_022932154.1 (prohibitin-3, mitochondrial [Cucurbita moschata] >XP_022932155.1 prohibitin-3, mitochondrial [Cucurbita moschata] >XP_022932156.1 prohibitin-3, mitochondrial [Cucurbita moschata] >XP_022932157.1 prohibitin-3, mitochondrial [Cucurbita moschata] >XP_022985248.1 prohibitin-3, mitochondrial [Cucurbita maxima] >XP_022985249.1 prohibitin-3, mitochondrial [Cucurbita maxima] >XP_022985250.1 prohibitin-3, mitochondrial [Cucurbita maxima] >XP_022985251.1 prohibitin-3, mitochondrial [Cucurbita maxima] >XP_023520430.1 prohibitin-3, mitochondrial [Cucurbita pepo subsp. pepo] >XP_023520431.1 prohibitin-3, mitochondrial [Cucurbita pepo subsp. pepo]) HSP 1 Score: 119.0 bits (297), Expect = 9.1e-24 Identity = 83/177 (46.89%), Postives = 87/177 (49.15%), Query Frame = 0
BLAST of MELO3C023182.2 vs. NCBI nr
Match: XP_022955467.1 (prohibitin-3, mitochondrial-like [Cucurbita moschata]) HSP 1 Score: 117.9 bits (294), Expect = 2.0e-23 Identity = 82/177 (46.33%), Postives = 87/177 (49.15%), Query Frame = 0
BLAST of MELO3C023182.2 vs. TAIR10
Match: AT5G40770.1 (prohibitin 3) HSP 1 Score: 80.9 bits (198), Expect = 5.0e-16 Identity = 66/177 (37.29%), Postives = 78/177 (44.07%), Query Frame = 0
BLAST of MELO3C023182.2 vs. TAIR10
Match: AT3G27280.2 (prohibitin 4) HSP 1 Score: 79.3 bits (194), Expect = 1.5e-15 Identity = 65/177 (36.72%), Postives = 78/177 (44.07%), Query Frame = 0
BLAST of MELO3C023182.2 vs. TAIR10
Match: AT5G14300.1 (prohibitin 5) HSP 1 Score: 72.0 bits (175), Expect = 2.3e-13 Identity = 36/62 (58.06%), Postives = 48/62 (77.42%), Query Frame = 0
BLAST of MELO3C023182.2 vs. TAIR10
Match: AT1G03860.1 (prohibitin 2) HSP 1 Score: 53.1 bits (126), Expect = 1.1e-07 Identity = 30/62 (48.39%), Postives = 44/62 (70.97%), Query Frame = 0
BLAST of MELO3C023182.2 vs. TAIR10
Match: AT5G44140.1 (prohibitin 7) HSP 1 Score: 52.0 bits (123), Expect = 2.5e-07 Identity = 30/62 (48.39%), Postives = 44/62 (70.97%), Query Frame = 0
BLAST of MELO3C023182.2 vs. Swiss-Prot
Match: sp|O04331|PHB3_ARATH (Prohibitin-3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PHB3 PE=1 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 9.0e-15 Identity = 66/177 (37.29%), Postives = 78/177 (44.07%), Query Frame = 0
BLAST of MELO3C023182.2 vs. Swiss-Prot
Match: sp|Q9LK25|PHB4_ARATH (Prohibitin-4, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PHB4 PE=1 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 2.6e-14 Identity = 65/177 (36.72%), Postives = 78/177 (44.07%), Query Frame = 0
BLAST of MELO3C023182.2 vs. Swiss-Prot
Match: sp|Q9LY99|PHB5_ARATH (Prohibitin-5, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PHB5 PE=1 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 4.2e-12 Identity = 36/62 (58.06%), Postives = 48/62 (77.42%), Query Frame = 0
BLAST of MELO3C023182.2 vs. Swiss-Prot
Match: sp|P40961|PHB1_YEAST (Prohibitin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PHB1 PE=1 SV=2) HSP 1 Score: 70.9 bits (172), Expect = 9.3e-12 Identity = 53/174 (30.46%), Postives = 74/174 (42.53%), Query Frame = 0
BLAST of MELO3C023182.2 vs. Swiss-Prot
Match: sp|Q9P7H3|PHB1_SCHPO (Prohibitin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=phb1 PE=3 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 2.8e-08 Identity = 49/175 (28.00%), Postives = 69/175 (39.43%), Query Frame = 0
BLAST of MELO3C023182.2 vs. TrEMBL
Match: tr|A0A1S3BVE0|A0A1S3BVE0_CUCME (prohibitin-3, mitochondrial OS=Cucumis melo OX=3656 GN=LOC103493907 PE=4 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 2.1e-24 Identity = 84/177 (47.46%), Postives = 88/177 (49.72%), Query Frame = 0
BLAST of MELO3C023182.2 vs. TrEMBL
Match: tr|A0A0A0LP53|A0A0A0LP53_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G004910 PE=4 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 2.1e-24 Identity = 84/177 (47.46%), Postives = 88/177 (49.72%), Query Frame = 0
BLAST of MELO3C023182.2 vs. TrEMBL
Match: tr|A0A0B2RQB4|A0A0B2RQB4_GLYSO (Prohibitin-1 OS=Glycine soja OX=3848 GN=glysoja_047628 PE=4 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 2.7e-24 Identity = 73/131 (55.73%), Postives = 83/131 (63.36%), Query Frame = 0
BLAST of MELO3C023182.2 vs. TrEMBL
Match: tr|W9S8G3|W9S8G3_9ROSA (Prohibitin-1 OS=Morus notabilis OX=981085 GN=L484_017655 PE=4 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 3.0e-23 Identity = 80/177 (45.20%), Postives = 87/177 (49.15%), Query Frame = 0
BLAST of MELO3C023182.2 vs. TrEMBL
Match: tr|A0A2P5B5F1|A0A2P5B5F1_PARAD (Prohibitin OS=Parasponia andersonii OX=3476 GN=PanWU01x14_269460 PE=4 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 1.5e-22 Identity = 80/177 (45.20%), Postives = 86/177 (48.59%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|