MELO3C023149 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGAGCAGAGGATTTCAGCTTCTACTCCCAACACATTCCTGCTGTATTTTTCATGATCAGAGCGAAGAACGATATGATGAAATCCGGAATACCGTTGCACTTGCCCTACCTTGTCTTGGATGAACAAGTTCTTCCACTTGGAGCTTCTCTTCATGCTGCTGTTGCAATTTCTTACTTAGCTCAACAACATTATTCTGTTTCCAGCAATTAA ATGGGAGCAGAGGATTTCAGCTTCTACTCCCAACACATTCCTGCTGTATTTTTCATGATCAGAGCGAAGAACGATATGATGAAATCCGGAATACCGTTGCACTTGCCCTACCTTGTCTTGGATGAACAAGTTCTTCCACTTGGAGCTTCTCTTCATGCTGCTGTTGCAATTTCTTACTTAGCTCAACAACATTATTCTGTTTCCAGCAATTAA ATGGGAGCAGAGGATTTCAGCTTCTACTCCCAACACATTCCTGCTGTATTTTTCATGATCAGAGCGAAGAACGATATGATGAAATCCGGAATACCGTTGCACTTGCCCTACCTTGTCTTGGATGAACAAGTTCTTCCACTTGGAGCTTCTCTTCATGCTGCTGTTGCAATTTCTTACTTAGCTCAACAACATTATTCTGTTTCCAGCAATTAA MGAEDFSFYSQHIPAVFFMIRAKNDMMKSGIPLHLPYLVLDEQVLPLGASLHAAVAISYLAQQHYSVSSN*
BLAST of MELO3C023149 vs. Swiss-Prot
Match: ILL7_ORYSJ (IAA-amino acid hydrolase ILR1-like 7 OS=Oryza sativa subsp. japonica GN=ILL7 PE=2 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 1.6e-13 Identity = 36/69 (52.17%), Postives = 48/69 (69.57%), Query Frame = 1
BLAST of MELO3C023149 vs. Swiss-Prot
Match: ILR1_ARATH (IAA-amino acid hydrolase ILR1 OS=Arabidopsis thaliana GN=ILR1 PE=1 SV=2) HSP 1 Score: 75.9 bits (185), Expect = 2.0e-13 Identity = 33/66 (50.00%), Postives = 46/66 (69.70%), Query Frame = 1
BLAST of MELO3C023149 vs. Swiss-Prot
Match: ILL6_ORYSJ (IAA-amino acid hydrolase ILR1-like 6 OS=Oryza sativa subsp. japonica GN=ILL6 PE=2 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.3e-12 Identity = 37/70 (52.86%), Postives = 45/70 (64.29%), Query Frame = 1
BLAST of MELO3C023149 vs. Swiss-Prot
Match: ILL6_ARATH (IAA-amino acid hydrolase ILR1-like 6 OS=Arabidopsis thaliana GN=ILL6 PE=2 SV=2) HSP 1 Score: 68.2 bits (165), Expect = 4.2e-11 Identity = 32/64 (50.00%), Postives = 43/64 (67.19%), Query Frame = 1
BLAST of MELO3C023149 vs. Swiss-Prot
Match: ILL3_ORYSJ (IAA-amino acid hydrolase ILR1-like 3 OS=Oryza sativa subsp. japonica GN=ILL3 PE=2 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 1.2e-10 Identity = 36/65 (55.38%), Postives = 42/65 (64.62%), Query Frame = 1
BLAST of MELO3C023149 vs. TrEMBL
Match: A0A0A0LGQ7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G778230 PE=4 SV=1) HSP 1 Score: 122.1 bits (305), Expect = 2.7e-25 Identity = 60/70 (85.71%), Postives = 63/70 (90.00%), Query Frame = 1
BLAST of MELO3C023149 vs. TrEMBL
Match: A0A0A0LEN6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G778240 PE=4 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 7.2e-18 Identity = 48/70 (68.57%), Postives = 56/70 (80.00%), Query Frame = 1
BLAST of MELO3C023149 vs. TrEMBL
Match: F6HKP0_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_08s0007g02770 PE=4 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 7.5e-15 Identity = 41/60 (68.33%), Postives = 48/60 (80.00%), Query Frame = 1
BLAST of MELO3C023149 vs. TrEMBL
Match: A5BVN7_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_017036 PE=4 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 7.5e-15 Identity = 41/60 (68.33%), Postives = 48/60 (80.00%), Query Frame = 1
BLAST of MELO3C023149 vs. TrEMBL
Match: F6HKP2_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_08s0007g02740 PE=4 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 1.7e-14 Identity = 40/60 (66.67%), Postives = 48/60 (80.00%), Query Frame = 1
BLAST of MELO3C023149 vs. TAIR10
Match: AT3G02875.1 (AT3G02875.1 Peptidase M20/M25/M40 family protein) HSP 1 Score: 75.9 bits (185), Expect = 1.1e-14 Identity = 33/66 (50.00%), Postives = 46/66 (69.70%), Query Frame = 1
BLAST of MELO3C023149 vs. TAIR10
Match: AT1G44350.1 (AT1G44350.1 IAA-leucine resistant (ILR)-like gene 6) HSP 1 Score: 68.2 bits (165), Expect = 2.4e-12 Identity = 32/64 (50.00%), Postives = 43/64 (67.19%), Query Frame = 1
BLAST of MELO3C023149 vs. TAIR10
Match: AT1G51760.1 (AT1G51760.1 peptidase M20/M25/M40 family protein) HSP 1 Score: 58.5 bits (140), Expect = 1.9e-09 Identity = 28/62 (45.16%), Postives = 36/62 (58.06%), Query Frame = 1
BLAST of MELO3C023149 vs. TAIR10
Match: AT5G54140.1 (AT5G54140.1 IAA-leucine-resistant (ILR1)-like 3) HSP 1 Score: 57.0 bits (136), Expect = 5.5e-09 Identity = 29/64 (45.31%), Postives = 38/64 (59.38%), Query Frame = 1
BLAST of MELO3C023149 vs. TAIR10
Match: AT5G56650.1 (AT5G56650.1 IAA-leucine resistant (ILR)-like 1) HSP 1 Score: 49.7 bits (117), Expect = 8.8e-07 Identity = 23/60 (38.33%), Postives = 37/60 (61.67%), Query Frame = 1
BLAST of MELO3C023149 vs. NCBI nr
Match: gi|449437434|ref|XP_004136497.1| (PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Cucumis sativus]) HSP 1 Score: 122.1 bits (305), Expect = 3.9e-25 Identity = 60/70 (85.71%), Postives = 63/70 (90.00%), Query Frame = 1
BLAST of MELO3C023149 vs. NCBI nr
Match: gi|659084428|ref|XP_008442881.1| (PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Cucumis melo]) HSP 1 Score: 106.7 bits (265), Expect = 1.7e-20 Identity = 56/70 (80.00%), Postives = 59/70 (84.29%), Query Frame = 1
BLAST of MELO3C023149 vs. NCBI nr
Match: gi|659085762|ref|XP_008443589.1| (PREDICTED: IAA-amino acid hydrolase ILR1-like 8, partial [Cucumis melo]) HSP 1 Score: 98.6 bits (244), Expect = 4.7e-18 Identity = 49/70 (70.00%), Postives = 57/70 (81.43%), Query Frame = 1
BLAST of MELO3C023149 vs. NCBI nr
Match: gi|449437436|ref|XP_004136498.1| (PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Cucumis sativus]) HSP 1 Score: 97.4 bits (241), Expect = 1.0e-17 Identity = 48/70 (68.57%), Postives = 56/70 (80.00%), Query Frame = 1
BLAST of MELO3C023149 vs. NCBI nr
Match: gi|719974916|ref|XP_010246176.1| (PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Nelumbo nucifera]) HSP 1 Score: 89.0 bits (219), Expect = 3.7e-15 Identity = 42/60 (70.00%), Postives = 49/60 (81.67%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|