MELO3C023026 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGTACAAGGGATCAGAGGTTACACGAAAAGTGACATGGATTATTTTTTATGAAGTACACTACATGTGTGATTGGGAGCGAGGTGTTGTTAGGGAAGAGAGCATTGTCATGACTCCAAAAAATGCTCGATTTGTTTTCCTCAGCAACTGTACCAAATGCAAAAGAATTTGCTACTTGGGTTGCAAAG ATGAAGTACAAGGGATCAGAGGTTACACGAAAAGTGACATGGATTATTTTTTATGAAGTACACTACATGTGTGATTGGGAGCGAGGTGTTGTTAGGGAAGAGAGCATTGTCATGACTCCAAAAAATGCTCGATTTGTTTTCCTCAGCAACTGTACCAAATGCAAAAGAATTTGCTACTTGGGTTGCAAAG ATGAAGTACAAGGGATCAGAGGTTACACGAAAAGTGACATGGATTATTTTTTATGAAGTACACTACATGTGTGATTGGGAGCGAGGTGTTGTTAGGGAAGAGAGCATTGTCATGACTCCAAAAAATGCTCGATTTGTTTTCCTCAGCAACTGTACCAAATGCAAAAGAATTTGCTACTTGGGTTGCAAAG MKYKGSEVTRKVTWIIFYEVHYMCDWERGVVREESIVMTPKNARFVFLSNCTKCKRICYLGCK
BLAST of MELO3C023026 vs. Swiss-Prot
Match: MTR4_ARATH (DExH-box ATP-dependent RNA helicase DExH9 OS=Arabidopsis thaliana GN=MTR4 PE=2 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 2.8e-14 Identity = 38/49 (77.55%), Postives = 40/49 (81.63%), Query Frame = 1
BLAST of MELO3C023026 vs. Swiss-Prot
Match: MTR4_YEAST (ATP-dependent RNA helicase DOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTR4 PE=1 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 8.4e-11 Identity = 31/49 (63.27%), Postives = 36/49 (73.47%), Query Frame = 1
BLAST of MELO3C023026 vs. Swiss-Prot
Match: SK2L2_HUMAN (Superkiller viralicidic activity 2-like 2 OS=Homo sapiens GN=SKIV2L2 PE=1 SV=3) HSP 1 Score: 67.0 bits (162), Expect = 8.4e-11 Identity = 30/49 (61.22%), Postives = 36/49 (73.47%), Query Frame = 1
BLAST of MELO3C023026 vs. Swiss-Prot
Match: SK2L2_MOUSE (Superkiller viralicidic activity 2-like 2 OS=Mus musculus GN=Skiv2l2 PE=1 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 8.4e-11 Identity = 30/49 (61.22%), Postives = 36/49 (73.47%), Query Frame = 1
BLAST of MELO3C023026 vs. Swiss-Prot
Match: MTR4_SCHPO (ATP-dependent RNA helicase mtr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mtr4 PE=1 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 1.4e-10 Identity = 30/49 (61.22%), Postives = 36/49 (73.47%), Query Frame = 1
BLAST of MELO3C023026 vs. TrEMBL
Match: G7KSG0_MEDTR (Superkiller viralicidic activity-like protein OS=Medicago truncatula GN=MTR_7g080730 PE=4 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 1.6e-13 Identity = 41/49 (83.67%), Postives = 44/49 (89.80%), Query Frame = 1
BLAST of MELO3C023026 vs. TrEMBL
Match: M5W7L7_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa000814mg PE=4 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 2.1e-13 Identity = 41/49 (83.67%), Postives = 43/49 (87.76%), Query Frame = 1
BLAST of MELO3C023026 vs. TrEMBL
Match: D2J0B1_CUCSA (ATP-dependent RNA helicase (Fragment) OS=Cucumis sativus PE=2 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 2.1e-13 Identity = 41/49 (83.67%), Postives = 43/49 (87.76%), Query Frame = 1
BLAST of MELO3C023026 vs. TrEMBL
Match: A0A0A0KFR7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G109760 PE=4 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 2.1e-13 Identity = 41/49 (83.67%), Postives = 43/49 (87.76%), Query Frame = 1
BLAST of MELO3C023026 vs. TrEMBL
Match: A0A124SCE6_CYNCS (DNA/RNA helicase, DEAD/DEAH box type, N-terminal OS=Cynara cardunculus var. scolymus GN=Ccrd_004412 PE=4 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 2.8e-13 Identity = 40/49 (81.63%), Postives = 43/49 (87.76%), Query Frame = 1
BLAST of MELO3C023026 vs. TAIR10
Match: AT1G59760.1 (AT1G59760.1 RNA helicase, ATP-dependent, SK12/DOB1 protein) HSP 1 Score: 78.6 bits (192), Expect = 1.6e-15 Identity = 38/49 (77.55%), Postives = 40/49 (81.63%), Query Frame = 1
BLAST of MELO3C023026 vs. TAIR10
Match: AT2G06990.1 (AT2G06990.1 RNA helicase, ATP-dependent, SK12/DOB1 protein) HSP 1 Score: 65.1 bits (157), Expect = 1.8e-11 Identity = 35/65 (53.85%), Postives = 42/65 (64.62%), Query Frame = 1
BLAST of MELO3C023026 vs. TAIR10
Match: AT3G46960.1 (AT3G46960.1 RNA helicase, ATP-dependent, SK12/DOB1 protein) HSP 1 Score: 59.3 bits (142), Expect = 9.8e-10 Identity = 26/49 (53.06%), Postives = 34/49 (69.39%), Query Frame = 1
BLAST of MELO3C023026 vs. NCBI nr
Match: gi|1012123090|ref|XP_015962906.1| (PREDICTED: DExH-box ATP-dependent RNA helicase DExH9 [Arachis duranensis]) HSP 1 Score: 82.8 bits (203), Expect = 2.4e-13 Identity = 41/49 (83.67%), Postives = 44/49 (89.80%), Query Frame = 1
BLAST of MELO3C023026 vs. NCBI nr
Match: gi|502090155|ref|XP_004489138.1| (PREDICTED: superkiller viralicidic activity 2-like 2 [Cicer arietinum]) HSP 1 Score: 82.8 bits (203), Expect = 2.4e-13 Identity = 41/49 (83.67%), Postives = 44/49 (89.80%), Query Frame = 1
BLAST of MELO3C023026 vs. NCBI nr
Match: gi|357507885|ref|XP_003624231.1| (superkiller viralicidic activity-like protein [Medicago truncatula]) HSP 1 Score: 82.8 bits (203), Expect = 2.4e-13 Identity = 41/49 (83.67%), Postives = 44/49 (89.80%), Query Frame = 1
BLAST of MELO3C023026 vs. NCBI nr
Match: gi|1021503192|ref|XP_016194819.1| (PREDICTED: DExH-box ATP-dependent RNA helicase DExH9 [Arachis ipaensis]) HSP 1 Score: 82.8 bits (203), Expect = 2.4e-13 Identity = 41/49 (83.67%), Postives = 44/49 (89.80%), Query Frame = 1
BLAST of MELO3C023026 vs. NCBI nr
Match: gi|645217626|ref|XP_008226685.1| (PREDICTED: superkiller viralicidic activity 2-like 2 [Prunus mume]) HSP 1 Score: 82.4 bits (202), Expect = 3.1e-13 Identity = 41/49 (83.67%), Postives = 43/49 (87.76%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |