MELO3C022944 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAATCCACTGATTTCTGCCGCTTCCGTTATTGCTGCTGGGTTGGCCGTCGGGCTTGCTTCTATTGGACCTGGGATTGGTCAAGGTACTGCTGCGAGCCAAGCTGTAGAAGGGATCGCGAGACAACCCGAGGCGGAGGGAAAAATCCGAGGTACTTTATTGATGTACAAAGTGTCATTCTCTCCCAAATATGCATACTTTAGGTGGTTGGGTAAAGGCTTGAGCTCTATTTCTGGTGGTTCTTCGATTGATGACTTTATCTTCTTCTTGCCTTTGGTTTTCAGGTCCAAAGACTCAAACTTTGTTTTGCCCAACATGACGTTTACTTCTTCCAGTATATAA ATGAATCCACTGATTTCTGCCGCTTCCGTTATTGCTGCTGGGTTGGCCGTCGGGCTTGCTTCTATTGGACCTGGGATTGGTCAAGGTACTGCTGCGAGCCAAGCTGTAGAAGGGATCGCGAGACAACCCGAGGCGGAGGGAAAAATCCGAGGTACTTTATTGATGTACAAAGTGTCATTCTCTCCCAAATATGCATACTTTAGGTGGTTGGGTAAAGGCTTGAGCTCTATTTCTGGTGGTTCTTCGATTGATGACTTTATCTTCTTCTTGCCTTTGGTTTTCAGGTCCAAAGACTCAAACTTTGTTTTGCCCAACATGACGTTTACTTCTTCCAGTATATAA ATGAATCCACTGATTTCTGCCGCTTCCGTTATTGCTGCTGGGTTGGCCGTCGGGCTTGCTTCTATTGGACCTGGGATTGGTCAAGGTACTGCTGCGAGCCAAGCTGTAGAAGGGATCGCGAGACAACCCGAGGCGGAGGGAAAAATCCGAGGTACTTTATTGATGTACAAAGTGTCATTCTCTCCCAAATATGCATACTTTAGGTGGTTGGGTAAAGGCTTGAGCTCTATTTCTGGTGGTTCTTCGATTGATGACTTTATCTTCTTCTTGCCTTTGGTTTTCAGGTCCAAAGACTCAAACTTTGTTTTGCCCAACATGACGTTTACTTCTTCCAGTATATAA MNPLISAASVIAAGLAVGLASIGPGIGQGTAASQAVEGIARQPEAEGKIRGTLLMYKVSFSPKYAYFRWLGKGLSSISGGSSIDDFIFFLPLVFRSKDSNFVLPNMTFTSSSI*
BLAST of MELO3C022944 vs. Swiss-Prot
Match: ATPH_MARPO (ATP synthase subunit c, chloroplastic OS=Marchantia polymorpha GN=atpH PE=3 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 2.5e-21 Identity = 53/55 (96.36%), Postives = 52/55 (94.55%), Query Frame = 1
BLAST of MELO3C022944 vs. Swiss-Prot
Match: ATPH_PELHO (ATP synthase subunit c, chloroplastic OS=Pelargonium hortorum GN=atpH PE=3 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 2.5e-21 Identity = 53/55 (96.36%), Postives = 52/55 (94.55%), Query Frame = 1
BLAST of MELO3C022944 vs. Swiss-Prot
Match: ATPH_TRACE (ATP synthase subunit c, chloroplastic OS=Trachelium caeruleum GN=atpH PE=3 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 2.5e-21 Identity = 53/55 (96.36%), Postives = 52/55 (94.55%), Query Frame = 1
BLAST of MELO3C022944 vs. Swiss-Prot
Match: ATPH_SOLTU (ATP synthase subunit c, chloroplastic OS=Solanum tuberosum GN=atpH PE=3 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 2.5e-21 Identity = 53/55 (96.36%), Postives = 52/55 (94.55%), Query Frame = 1
BLAST of MELO3C022944 vs. Swiss-Prot
Match: ATPH_PIPCE (ATP synthase subunit c, chloroplastic OS=Piper cenocladum GN=atpH PE=3 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 2.5e-21 Identity = 53/55 (96.36%), Postives = 52/55 (94.55%), Query Frame = 1
BLAST of MELO3C022944 vs. TrEMBL
Match: A0A0K1ZYL2_9ASTR (ATP synthase subunit c, chloroplastic OS=Verreauxia reinwardtii GN=atpH PE=3 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 2.8e-19 Identity = 53/55 (96.36%), Postives = 54/55 (98.18%), Query Frame = 1
BLAST of MELO3C022944 vs. TrEMBL
Match: U6A2W9_COSPU (ATP synthase CF0 subunit III OS=Costus pulverulentus GN=atpH PE=3 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 2.8e-19 Identity = 53/55 (96.36%), Postives = 54/55 (98.18%), Query Frame = 1
BLAST of MELO3C022944 vs. TrEMBL
Match: A0A0U2SNX2_9MYRT (ATP synthase subunit c, chloroplastic OS=Oenothera grandiflora GN=atpH PE=3 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 2.8e-19 Identity = 53/55 (96.36%), Postives = 54/55 (98.18%), Query Frame = 1
BLAST of MELO3C022944 vs. TrEMBL
Match: A0A0A0UQN8_9ASPA (ATP synthase CF0 subunit III OS=Corallorhiza wisteriana GN=atpH PE=3 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 2.8e-19 Identity = 53/55 (96.36%), Postives = 54/55 (98.18%), Query Frame = 1
BLAST of MELO3C022944 vs. TrEMBL
Match: A0A060DEF7_9BRYO (ATP synthase subunit c, chloroplastic OS=Tetraphis pellucida GN=atpH PE=3 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 2.8e-19 Identity = 53/55 (96.36%), Postives = 54/55 (98.18%), Query Frame = 1
BLAST of MELO3C022944 vs. TAIR10
Match: ATCG00140.1 (ATCG00140.1 ATP synthase subunit C family protein) HSP 1 Score: 102.1 bits (253), Expect = 2.4e-22 Identity = 51/55 (92.73%), Postives = 52/55 (94.55%), Query Frame = 1
BLAST of MELO3C022944 vs. NCBI nr
Match: gi|816379119|gb|AKF01755.1| (ATP synthase CF0 subunit III (chloroplast) [Iriartea deltoidea]) HSP 1 Score: 102.8 bits (255), Expect = 4.0e-19 Identity = 53/55 (96.36%), Postives = 54/55 (98.18%), Query Frame = 1
BLAST of MELO3C022944 vs. NCBI nr
Match: gi|11466684|ref|NP_039280.1| (ATP synthase CF0 C subunit (chloroplast) [Marchantia polymorpha]) HSP 1 Score: 102.8 bits (255), Expect = 4.0e-19 Identity = 53/55 (96.36%), Postives = 54/55 (98.18%), Query Frame = 1
BLAST of MELO3C022944 vs. NCBI nr
Match: gi|722491647|ref|YP_009109436.1| (ATP synthase III subunit (chloroplast) [Sanionia uncinata]) HSP 1 Score: 102.8 bits (255), Expect = 4.0e-19 Identity = 53/55 (96.36%), Postives = 54/55 (98.18%), Query Frame = 1
BLAST of MELO3C022944 vs. NCBI nr
Match: gi|725676302|ref|YP_009109195.1| (ATP synthase CF0 subunit III (plastid) [Corallorhiza wisteriana]) HSP 1 Score: 102.8 bits (255), Expect = 4.0e-19 Identity = 53/55 (96.36%), Postives = 54/55 (98.18%), Query Frame = 1
BLAST of MELO3C022944 vs. NCBI nr
Match: gi|927371887|ref|YP_009164185.1| (ATP synthase CF0 subunit III (chloroplast) [Viscum minimum]) HSP 1 Score: 102.4 bits (254), Expect = 5.2e-19 Identity = 52/55 (94.55%), Postives = 54/55 (98.18%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|