MELO3C022860 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TGCTTACGGTATTCTGAAATCTGAGGTCTTTACCGGATACCTGTTAGCTGGATCTCTCATTAGACCTGGAGGTTTAAGCTTTGTTGGTGAAATGGTGCAAGTATGTAACTTTTCTCCCTGATTATTTTCTGTTGTAACATTCTGTTTTATTATAAAGCTAAGAGATATACTTACTGGATTTTAGGCATCGGACAAAATTTGTAAATCTATTACATTTGGTTCATATGCTAACTGTAACATTAGGCTGTTGTTATTGAATGAGTATGTATACTTGTCAAAGCAAAATTTGACTTTTTTCTCAAATTTTTCTTTTTTTTTTCTTTTTTAAATTAGTTATGGAATAATGAATATTTAATTGTCTTGAGCATTATTATTGATTCTTATAAGTTATGGTACTATCAAGAATTTATGCTTTTGGAATCCCCGGATATTACCTTAATATATTAGATTGATTCACCAGAATTCAATCTGTCATTTACATATCCATTCAGGTTGAGACAGTAGCTAAGTTTGGTGTGATCTTCCTTCTTTTTGCATTGGGCCTGGAGTTCTCTACTACAAAAGTCAGCCTAACGTTTCTTCCAGATGTTTTTTTTTTCAACAATCGCTGGTTTACAACATATTTAGACTGTCAATAATCTCTCTGTTCTTTTCCAGCTTCGTGTGGTTCGAGCAGTGGCCGTTCTTGGAGGACTGCTTTAG TGCTTACGGTATTCTGAAATCTGAGGTCTTTACCGGATACCTGTTAGCTGGATCTCTCATTAGACCTGGAGGTTTAAGCTTTGTTGGTGAAATGGTGCAAGTTGAGACAGTAGCTAAGTTTGGTGTGATCTTCCTTCTTTTTGCATTGGGCCTGGAGTTCTCTACTACAAAACTTCGTGTGGTTCGAGCAGTGGCCGTTCTTGGAGGACTGCTTTAG TGCTTACGGTATTCTGAAATCTGAGGTCTTTACCGGATACCTGTTAGCTGGATCTCTCATTAGACCTGGAGGTTTAAGCTTTGTTGGTGAAATGGTGCAAGTTGAGACAGTAGCTAAGTTTGGTGTGATCTTCCTTCTTTTTGCATTGGGCCTGGAGTTCTCTACTACAAAACTTCGTGTGGTTCGAGCAGTGGCCGTTCTTGGAGGACTGCTTTAG AYGILKSEVFTGYLLAGSLIRPGGLSFVGEMVQVETVAKFGVIFLLFALGLEFSTTKLRVVRAVAVLGGLL*
BLAST of MELO3C022860 vs. Swiss-Prot
Match: KEA6_ARATH (K(+) efflux antiporter 6 OS=Arabidopsis thaliana GN=KEA6 PE=2 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 1.9e-22 Identity = 53/71 (74.65%), Postives = 59/71 (83.10%), Query Frame = 1
BLAST of MELO3C022860 vs. Swiss-Prot
Match: KEA4_ARATH (K(+) efflux antiporter 4 OS=Arabidopsis thaliana GN=KEA4 PE=2 SV=2) HSP 1 Score: 105.1 bits (261), Expect = 3.2e-22 Identity = 55/71 (77.46%), Postives = 57/71 (80.28%), Query Frame = 1
BLAST of MELO3C022860 vs. Swiss-Prot
Match: KEA5_ARATH (K(+) efflux antiporter 5 OS=Arabidopsis thaliana GN=KEA5 PE=2 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 1.0e-20 Identity = 51/70 (72.86%), Postives = 55/70 (78.57%), Query Frame = 1
BLAST of MELO3C022860 vs. Swiss-Prot
Match: TMCO3_MOUSE (Transmembrane and coiled-coil domain-containing protein 3 OS=Mus musculus GN=Tmco3 PE=2 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 1.5e-08 Identity = 28/57 (49.12%), Postives = 38/57 (66.67%), Query Frame = 1
BLAST of MELO3C022860 vs. Swiss-Prot
Match: TMCO3_HUMAN (Transmembrane and coiled-coil domain-containing protein 3 OS=Homo sapiens GN=TMCO3 PE=2 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 1.5e-08 Identity = 28/57 (49.12%), Postives = 38/57 (66.67%), Query Frame = 1
BLAST of MELO3C022860 vs. TrEMBL
Match: A0A0A0M1W9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G586880 PE=4 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 3.4e-23 Identity = 61/71 (85.92%), Postives = 63/71 (88.73%), Query Frame = 1
BLAST of MELO3C022860 vs. TrEMBL
Match: A0A061GLS7_THECC (K+ efflux antiporter 4 isoform 4 OS=Theobroma cacao GN=TCM_037686 PE=4 SV=1) HSP 1 Score: 113.6 bits (283), Expect = 9.9e-23 Identity = 60/71 (84.51%), Postives = 62/71 (87.32%), Query Frame = 1
BLAST of MELO3C022860 vs. TrEMBL
Match: A0A061GTM0_THECC (K+ efflux antiporter 4 isoform 2 OS=Theobroma cacao GN=TCM_037686 PE=4 SV=1) HSP 1 Score: 113.6 bits (283), Expect = 9.9e-23 Identity = 60/71 (84.51%), Postives = 62/71 (87.32%), Query Frame = 1
BLAST of MELO3C022860 vs. TrEMBL
Match: A0A061GM39_THECC (K+ efflux antiporter 4 isoform 1 OS=Theobroma cacao GN=TCM_037686 PE=4 SV=1) HSP 1 Score: 113.6 bits (283), Expect = 9.9e-23 Identity = 60/71 (84.51%), Postives = 62/71 (87.32%), Query Frame = 1
BLAST of MELO3C022860 vs. TrEMBL
Match: A0A061GKS8_THECC (K+ efflux antiporter 4 isoform 3 OS=Theobroma cacao GN=TCM_037686 PE=4 SV=1) HSP 1 Score: 113.6 bits (283), Expect = 9.9e-23 Identity = 60/71 (84.51%), Postives = 62/71 (87.32%), Query Frame = 1
BLAST of MELO3C022860 vs. TAIR10
Match: AT5G11800.1 (AT5G11800.1 K+ efflux antiporter 6) HSP 1 Score: 105.9 bits (263), Expect = 1.0e-23 Identity = 53/71 (74.65%), Postives = 59/71 (83.10%), Query Frame = 1
BLAST of MELO3C022860 vs. TAIR10
Match: AT2G19600.1 (AT2G19600.1 K+ efflux antiporter 4) HSP 1 Score: 105.1 bits (261), Expect = 1.8e-23 Identity = 55/71 (77.46%), Postives = 57/71 (80.28%), Query Frame = 1
BLAST of MELO3C022860 vs. TAIR10
Match: AT5G51710.1 (AT5G51710.1 K+ efflux antiporter 5) HSP 1 Score: 100.1 bits (248), Expect = 5.7e-22 Identity = 51/70 (72.86%), Postives = 55/70 (78.57%), Query Frame = 1
BLAST of MELO3C022860 vs. TAIR10
Match: AT4G00630.2 (AT4G00630.2 K+ efflux antiporter 2) HSP 1 Score: 49.7 bits (117), Expect = 8.9e-07 Identity = 24/47 (51.06%), Postives = 31/47 (65.96%), Query Frame = 1
BLAST of MELO3C022860 vs. TAIR10
Match: AT1G01790.1 (AT1G01790.1 K+ efflux antiporter 1) HSP 1 Score: 49.3 bits (116), Expect = 1.2e-06 Identity = 24/47 (51.06%), Postives = 31/47 (65.96%), Query Frame = 1
BLAST of MELO3C022860 vs. NCBI nr
Match: gi|449435844|ref|XP_004135704.1| (PREDICTED: K(+) efflux antiporter 4 [Cucumis sativus]) HSP 1 Score: 115.2 bits (287), Expect = 4.9e-23 Identity = 61/71 (85.92%), Postives = 63/71 (88.73%), Query Frame = 1
BLAST of MELO3C022860 vs. NCBI nr
Match: gi|659099925|ref|XP_008450843.1| (PREDICTED: K(+) efflux antiporter 4 [Cucumis melo]) HSP 1 Score: 115.2 bits (287), Expect = 4.9e-23 Identity = 61/71 (85.92%), Postives = 63/71 (88.73%), Query Frame = 1
BLAST of MELO3C022860 vs. NCBI nr
Match: gi|590576101|ref|XP_007012870.1| (K+ efflux antiporter 4 isoform 2 [Theobroma cacao]) HSP 1 Score: 113.6 bits (283), Expect = 1.4e-22 Identity = 60/71 (84.51%), Postives = 62/71 (87.32%), Query Frame = 1
BLAST of MELO3C022860 vs. NCBI nr
Match: gi|590576097|ref|XP_007012869.1| (K+ efflux antiporter 4 isoform 1 [Theobroma cacao]) HSP 1 Score: 113.6 bits (283), Expect = 1.4e-22 Identity = 60/71 (84.51%), Postives = 62/71 (87.32%), Query Frame = 1
BLAST of MELO3C022860 vs. NCBI nr
Match: gi|590576109|ref|XP_007012872.1| (K+ efflux antiporter 4 isoform 4 [Theobroma cacao]) HSP 1 Score: 113.6 bits (283), Expect = 1.4e-22 Identity = 60/71 (84.51%), Postives = 62/71 (87.32%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|