MELO3C022836 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTTCGACTATTCCTCAAGCCCGACAATTAGTTAATCATAGACATATTTTAGTTAATGGTTCTATAGTGGATATACCAAGTTATCGGTGCAAACCCCGAGATATTATTACAGCAAAAGATGAAAAAAAATCGAGAACACTTATTTAA ATGGCTTCGACTATTCCTCAAGCCCGACAATTAGTTAATCATAGACATATTTTAGTTAATGGTTCTATAGTGGATATACCAAGTTATCGGTGCAAACCCCGAGATATTATTACAGCAAAAGATGAAAAAAAATCGAGAACACTTATTTAA ATGGCTTCGACTATTCCTCAAGCCCGACAATTAGTTAATCATAGACATATTTTAGTTAATGGTTCTATAGTGGATATACCAAGTTATCGGTGCAAACCCCGAGATATTATTACAGCAAAAGATGAAAAAAAATCGAGAACACTTATTTAA MASTIPQARQLVNHRHILVNGSIVDIPSYRCKPRDIITAKDEKKSRTLI*
BLAST of MELO3C022836 vs. Swiss-Prot
Match: RR4_CUCSA (30S ribosomal protein S4, chloroplastic OS=Cucumis sativus GN=rps4 PE=3 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 5.4e-21 Identity = 49/49 (100.00%), Postives = 47/49 (95.92%), Query Frame = 1
BLAST of MELO3C022836 vs. Swiss-Prot
Match: RR4_ATRBE (30S ribosomal protein S4, chloroplastic OS=Atropa belladonna GN=rps4 PE=3 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 1.1e-18 Identity = 45/49 (91.84%), Postives = 44/49 (89.80%), Query Frame = 1
BLAST of MELO3C022836 vs. Swiss-Prot
Match: RR4_SOLBU (30S ribosomal protein S4, chloroplastic OS=Solanum bulbocastanum GN=rps4 PE=3 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 1.1e-18 Identity = 45/49 (91.84%), Postives = 44/49 (89.80%), Query Frame = 1
BLAST of MELO3C022836 vs. Swiss-Prot
Match: RR4_TOBAC (30S ribosomal protein S4, chloroplastic OS=Nicotiana tabacum GN=rps4 PE=3 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 1.1e-18 Identity = 45/49 (91.84%), Postives = 44/49 (89.80%), Query Frame = 1
BLAST of MELO3C022836 vs. Swiss-Prot
Match: RR4_SOLTU (30S ribosomal protein S4, chloroplastic OS=Solanum tuberosum GN=rps4 PE=3 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 1.1e-18 Identity = 45/49 (91.84%), Postives = 44/49 (89.80%), Query Frame = 1
BLAST of MELO3C022836 vs. TrEMBL
Match: W8E3C8_9ROSI (Ribosomal protein S4 OS=Cucumis hystrix GN=rps4 PE=3 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 6.0e-19 Identity = 49/49 (100.00%), Postives = 49/49 (100.00%), Query Frame = 1
BLAST of MELO3C022836 vs. TrEMBL
Match: G3ETY7_CUCME (30S ribosomal protein S4, chloroplastic OS=Cucumis melo subsp. melo GN=rps4 PE=3 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 6.0e-19 Identity = 49/49 (100.00%), Postives = 49/49 (100.00%), Query Frame = 1
BLAST of MELO3C022836 vs. TrEMBL
Match: X2EY58_LAGSI (30S ribosomal protein S4, chloroplastic OS=Lagenaria siceraria GN=rps4 PE=3 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 2.3e-18 Identity = 48/49 (97.96%), Postives = 48/49 (97.96%), Query Frame = 1
BLAST of MELO3C022836 vs. TrEMBL
Match: X2F8K6_LAGSI (30S ribosomal protein S4, chloroplastic OS=Lagenaria siceraria GN=rps4 PE=3 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 2.3e-18 Identity = 48/49 (97.96%), Postives = 48/49 (97.96%), Query Frame = 1
BLAST of MELO3C022836 vs. TrEMBL
Match: X2F260_LAGSI (30S ribosomal protein S4, chloroplastic OS=Lagenaria siceraria GN=rps4 PE=3 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 2.3e-18 Identity = 48/49 (97.96%), Postives = 48/49 (97.96%), Query Frame = 1
BLAST of MELO3C022836 vs. TAIR10
Match: ATCG00380.1 (ATCG00380.1 chloroplast ribosomal protein S4) HSP 1 Score: 88.2 bits (217), Expect = 1.6e-18 Identity = 42/49 (85.71%), Postives = 42/49 (85.71%), Query Frame = 1
BLAST of MELO3C022836 vs. NCBI nr
Match: gi|346578193|ref|YP_004841785.1| (ribosomal protein S4 [Cucumis melo subsp. melo]) HSP 1 Score: 100.5 bits (249), Expect = 8.6e-19 Identity = 49/49 (100.00%), Postives = 49/49 (100.00%), Query Frame = 1
BLAST of MELO3C022836 vs. NCBI nr
Match: gi|68164805|ref|YP_247601.1| (ribosomal protein S4 [Cucumis sativus]) HSP 1 Score: 100.5 bits (249), Expect = 8.6e-19 Identity = 49/49 (100.00%), Postives = 49/49 (100.00%), Query Frame = 1
BLAST of MELO3C022836 vs. NCBI nr
Match: gi|595647760|gb|AHM91181.1| (ribosomal protein S4 (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 98.6 bits (244), Expect = 3.3e-18 Identity = 48/49 (97.96%), Postives = 48/49 (97.96%), Query Frame = 1
BLAST of MELO3C022836 vs. NCBI nr
Match: gi|595645420|gb|AHM88880.1| (ribosomal protein S4 (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 98.6 bits (244), Expect = 3.3e-18 Identity = 48/49 (97.96%), Postives = 48/49 (97.96%), Query Frame = 1
BLAST of MELO3C022836 vs. NCBI nr
Match: gi|595647819|gb|AHM91239.1| (ribosomal protein S4 (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 98.6 bits (244), Expect = 3.3e-18 Identity = 48/49 (97.96%), Postives = 48/49 (97.96%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|