MELO3C021967 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCAATTGTGCTGCCTGTTCAAAAATGGCGACCATATCTATTGGATAAGCCTTTTGTGGTGTGTACAAATCAGAAAAGTTTGAAGTTTCTTCTTGACCAACGAGCTATCGGGGGAGAATATCAGAGATGGATCGCTAAACTATTGGAGTATGATTTTGTGATTGAATACAAGAAGGGATTGGAAAACAAAGCGGCTGATGCCTTATCTAGATTACCACCAGTATTTGAATTGGGCCTCATAAGTGTTGTGGGTGGGCTAAATCCTTCGGTTTTCATTGACAAGTACCTGGAAATGAATCTCTTAAGAGTATTCGGTTATCCTTGA ATGGCAATTGTGCTGCCTGTTCAAAAATGGCGACCATATCTATTGGATAAGCCTTTTGTGGTGTGTACAAATCAGAAAAGTTTGAAGTTTCTTCTTGACCAACGAGCTATCGGGGGAGAATATCAGAGATGGATCGCTAAACTATTGGAGTATGATTTTGTGATTGAATACAAGAAGGGATTGGAAAACAAAGCGGCTGATGCCTTATCTAGATTACCACCAGTATTTGAATTGGGCCTCATAAGTGTTGTGGGTGGGCTAAATCCTTCGGTTTTCATTGACAAGTACCTGGAAATGAATCTCTTAAGAGTATTCGGTTATCCTTGA ATGGCAATTGTGCTGCCTGTTCAAAAATGGCGACCATATCTATTGGATAAGCCTTTTGTGGTGTGTACAAATCAGAAAAGTTTGAAGTTTCTTCTTGACCAACGAGCTATCGGGGGAGAATATCAGAGATGGATCGCTAAACTATTGGAGTATGATTTTGTGATTGAATACAAGAAGGGATTGGAAAACAAAGCGGCTGATGCCTTATCTAGATTACCACCAGTATTTGAATTGGGCCTCATAAGTGTTGTGGGTGGGCTAAATCCTTCGGTTTTCATTGACAAGTACCTGGAAATGAATCTCTTAAGAGTATTCGGTTATCCTTGA MAIVLPVQKWRPYLLDKPFVVCTNQKSLKFLLDQRAIGGEYQRWIAKLLEYDFVIEYKKGLENKAADALSRLPPVFELGLISVVGGLNPSVFIDKYLEMNLLRVFGYP*
BLAST of MELO3C021967 vs. Swiss-Prot
Match: POL2_DROME (Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster GN=pol PE=3 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 7.9e-09 Identity = 29/72 (40.28%), Postives = 45/72 (62.50%), Query Frame = 1
BLAST of MELO3C021967 vs. Swiss-Prot
Match: POL3_DROME (Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster GN=pol PE=3 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 5.7e-07 Identity = 29/72 (40.28%), Postives = 41/72 (56.94%), Query Frame = 1
BLAST of MELO3C021967 vs. TrEMBL
Match: A0A087H8D5_ARAAL (Uncharacterized protein OS=Arabis alpina GN=AALP_AA3G106900 PE=4 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 1.1e-20 Identity = 56/106 (52.83%), Postives = 76/106 (71.70%), Query Frame = 1
BLAST of MELO3C021967 vs. TrEMBL
Match: A0A087H2U0_ARAAL (Uncharacterized protein OS=Arabis alpina GN=AALP_AA4G124900 PE=4 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 1.8e-20 Identity = 54/106 (50.94%), Postives = 76/106 (71.70%), Query Frame = 1
BLAST of MELO3C021967 vs. TrEMBL
Match: A0A087H2T8_ARAAL (Uncharacterized protein OS=Arabis alpina GN=AALP_AA4G124900 PE=4 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 1.8e-20 Identity = 54/106 (50.94%), Postives = 76/106 (71.70%), Query Frame = 1
BLAST of MELO3C021967 vs. TrEMBL
Match: A0A087H2T9_ARAAL (Uncharacterized protein OS=Arabis alpina GN=AALP_AA4G124900 PE=4 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 1.8e-20 Identity = 54/106 (50.94%), Postives = 76/106 (71.70%), Query Frame = 1
BLAST of MELO3C021967 vs. TrEMBL
Match: A0A087G3S6_ARAAL (Uncharacterized protein (Fragment) OS=Arabis alpina GN=AALP_AAs46225U000100 PE=4 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 7.0e-20 Identity = 52/83 (62.65%), Postives = 63/83 (75.90%), Query Frame = 1
BLAST of MELO3C021967 vs. NCBI nr
Match: gi|923614274|ref|XP_013745228.1| (PREDICTED: uncharacterized protein LOC106447810 [Brassica napus]) HSP 1 Score: 110.2 bits (274), Expect = 2.4e-21 Identity = 56/83 (67.47%), Postives = 64/83 (77.11%), Query Frame = 1
BLAST of MELO3C021967 vs. NCBI nr
Match: gi|674245622|gb|KFK38387.1| (hypothetical protein AALP_AA3G106900 [Arabis alpina]) HSP 1 Score: 107.5 bits (267), Expect = 1.5e-20 Identity = 56/106 (52.83%), Postives = 76/106 (71.70%), Query Frame = 1
BLAST of MELO3C021967 vs. NCBI nr
Match: gi|674243675|gb|KFK36440.1| (hypothetical protein AALP_AA4G124900 [Arabis alpina]) HSP 1 Score: 106.7 bits (265), Expect = 2.6e-20 Identity = 54/106 (50.94%), Postives = 76/106 (71.70%), Query Frame = 1
BLAST of MELO3C021967 vs. NCBI nr
Match: gi|674243676|gb|KFK36441.1| (hypothetical protein AALP_AA4G124900 [Arabis alpina]) HSP 1 Score: 106.7 bits (265), Expect = 2.6e-20 Identity = 54/106 (50.94%), Postives = 76/106 (71.70%), Query Frame = 1
BLAST of MELO3C021967 vs. NCBI nr
Match: gi|674243677|gb|KFK36442.1| (hypothetical protein AALP_AA4G124900 [Arabis alpina]) HSP 1 Score: 106.7 bits (265), Expect = 2.6e-20 Identity = 54/106 (50.94%), Postives = 76/106 (71.70%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |