MELO3C021966 (gene) Melon (DHL92) v3.5.1

NameMELO3C021966
Typegene
OrganismCucumis melo (Melon (DHL92) v3.5.1)
Description30S ribosomal protein S4
Locationchr9 : 2466402 .. 2466656 (-)
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: polypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGGAGGCTAGGGTGATTGACCTGGAAGAAAGTTTGGACGGAGTAACCACGAGGATGACTGAAATGGAAAGTAGAGTAGAAGCAAAATTGATTGAGGATTTGAAACTCTTGGTGCAAGGTATCGAAGTGATAGGAAGTGCAACGAAAGGAAATACATCCGGTGAGAGAACGATCACAGACAAAGAAAAGGGAACAATGAGTGAAGAGCAAGTTCAAGGAGAAAAGAGTGAACAAAAAACTAACCCTAGAAAGTAA

mRNA sequence

ATGGAGGCTAGGGTGATTGACCTGGAAGAAAGTTTGGACGGAGTAACCACGAGGATGACTGAAATGGAAAGTAGAGTAGAAGCAAAATTGATTGAGGATTTGAAACTCTTGGTGCAAGGTATCGAAGTGATAGGAAGTGCAACGAAAGGAAATACATCCGGTGAGAGAACGATCACAGACAAAGAAAAGGGAACAATGAGTGAAGAGCAAGTTCAAGGAGAAAAGAGTGAACAAAAAACTAACCCTAGAAAGTAA

Coding sequence (CDS)

ATGGAGGCTAGGGTGATTGACCTGGAAGAAAGTTTGGACGGAGTAACCACGAGGATGACTGAAATGGAAAGTAGAGTAGAAGCAAAATTGATTGAGGATTTGAAACTCTTGGTGCAAGGTATCGAAGTGATAGGAAGTGCAACGAAAGGAAATACATCCGGTGAGAGAACGATCACAGACAAAGAAAAGGGAACAATGAGTGAAGAGCAAGTTCAAGGAGAAAAGAGTGAACAAAAAACTAACCCTAGAAAGTAA

Protein sequence

MEARVIDLEESLDGVTTRMTEMESRVEAKLIEDLKLLVQGIEVIGSATKGNTSGERTITDKEKGTMSEEQVQGEKSEQKTNPRK*
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0008150 biological_process
cellular_component GO:0005575 cellular_component
molecular_function GO:0003674 molecular_function
This gene is associated with the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
MU62821melon EST collection version 4.0transcribed_cluster

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
MELO3C021966T1MELO3C021966T1mRNA


The following transcribed_cluster feature(s) are associated with this gene:

Feature NameUnique NameType
MU62821MU62821transcribed_cluster


The following gene(s) are orthologous to this gene:

None

The following gene(s) are paralogous to this gene:

None

The following block(s) are covering this gene:
GeneOrganismBlock
MELO3C021966Watermelon (97103) v2mewmbB011
MELO3C021966Watermelon (97103) v2mewmbB014
MELO3C021966Watermelon (97103) v2mewmbB026
MELO3C021966Watermelon (97103) v2mewmbB038
MELO3C021966Wax gourdmewgoB046
MELO3C021966Melon (DHL92) v3.5.1memeB005
MELO3C021966Melon (DHL92) v3.5.1memeB012
MELO3C021966Melon (DHL92) v3.5.1memeB014
MELO3C021966Cucumber (Gy14) v1cgymeB114
MELO3C021966Cucumber (Gy14) v1cgymeB265
MELO3C021966Cucumber (Gy14) v1cgymeB472
MELO3C021966Cucumber (Gy14) v1cgymeB550
MELO3C021966Cucurbita maxima (Rimu)cmameB251
MELO3C021966Cucurbita maxima (Rimu)cmameB634
MELO3C021966Cucurbita moschata (Rifu)cmomeB239
MELO3C021966Cucurbita moschata (Rifu)cmomeB624
MELO3C021966Cucurbita moschata (Rifu)cmomeB630
MELO3C021966Wild cucumber (PI 183967)cpimeB000
MELO3C021966Wild cucumber (PI 183967)cpimeB165
MELO3C021966Wild cucumber (PI 183967)cpimeB349
MELO3C021966Wild cucumber (PI 183967)cpimeB354
MELO3C021966Cucumber (Chinese Long) v2cumeB005
MELO3C021966Cucumber (Chinese Long) v2cumeB174
MELO3C021966Cucumber (Chinese Long) v2cumeB358
MELO3C021966Watermelon (Charleston Gray)mewcgB002
MELO3C021966Watermelon (Charleston Gray)mewcgB007
MELO3C021966Watermelon (Charleston Gray)mewcgB029
MELO3C021966Watermelon (97103) v1mewmB003
MELO3C021966Watermelon (97103) v1mewmB008
MELO3C021966Watermelon (97103) v1mewmB021
MELO3C021966Cucurbita pepo (Zucchini)cpemeB155
MELO3C021966Cucurbita pepo (Zucchini)cpemeB358
MELO3C021966Cucurbita pepo (Zucchini)cpemeB467
MELO3C021966Bottle gourd (USVL1VR-Ls)lsimeB162
MELO3C021966Bottle gourd (USVL1VR-Ls)lsimeB163
MELO3C021966Cucumber (Gy14) v2cgybmeB001
MELO3C021966Cucumber (Gy14) v2cgybmeB299
MELO3C021966Silver-seed gourdcarmeB0260
MELO3C021966Silver-seed gourdcarmeB0682
MELO3C021966Wax gourdmewgoB022
MELO3C021966Cucumber (Chinese Long) v3cucmeB000
MELO3C021966Cucumber (Chinese Long) v3cucmeB167
MELO3C021966Cucumber (Chinese Long) v3cucmeB358