MELO3C021845.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGGCGGAGATGAGTCGAGATCCAAAAGTTTGGGAAGATCCGATGGAGTTTAAGCCGGAGAGGTTCTTGAAAGGCGGCGCCGGAAAAGAATGTGGAGTTGTGTTTGATATAACAGGGAGTAAAGAGATAAAGATGATGCCATTCGGAGCAGGGAGAAGAATGTGTCCTGGATTTGGTCTGGCAATTGTTCATTTGGAGTATTTCATTGCAAATTTGGTATGGAGGTTCGAATGGAAGGAAGTAAAGGGAGATGAAGTTAGTTTGGAAGAGAAAATAGAGTTCACAGTGGTGATGGAAAAGCCTTTGAAAGCGAACATAATTCCCAGGTGA ATGGTGGCGGAGATGAGTCGAGATCCAAAAGTTTGGGAAGATCCGATGGAGTTTAAGCCGGAGAGGTTCTTGAAAGGCGGCGCCGGAAAAGAATGTGGAGTTGTGTTTGATATAACAGGGAGTAAAGAGATAAAGATGATGCCATTCGGAGCAGGGAGAAGAATGTGTCCTGGATTTGGTCTGGCAATTGTTCATTTGGAGTATTTCATTGCAAATTTGGTATGGAGGTTCGAATGGAAGGAAGTAAAGGGAGATGAAGTTAGTTTGGAAGAGAAAATAGAGTTCACAGTGGTGATGGAAAAGCCTTTGAAAGCGAACATAATTCCCAGGTGA ATGGTGGCGGAGATGAGTCGAGATCCAAAAGTTTGGGAAGATCCGATGGAGTTTAAGCCGGAGAGGTTCTTGAAAGGCGGCGCCGGAAAAGAATGTGGAGTTGTGTTTGATATAACAGGGAGTAAAGAGATAAAGATGATGCCATTCGGAGCAGGGAGAAGAATGTGTCCTGGATTTGGTCTGGCAATTGTTCATTTGGAGTATTTCATTGCAAATTTGGTATGGAGGTTCGAATGGAAGGAAGTAAAGGGAGATGAAGTTAGTTTGGAAGAGAAAATAGAGTTCACAGTGGTGATGGAAAAGCCTTTGAAAGCGAACATAATTCCCAGGTGA MVAEMSRDPKVWEDPMEFKPERFLKGGAGKECGVVFDITGSKEIKMMPFGAGRRMCPGFGLAIVHLEYFIANLVWRFEWKEVKGDEVSLEEKIEFTVVMEKPLKANIIPR
BLAST of MELO3C021845.2 vs. NCBI nr
Match: XP_008459270.1 (PREDICTED: cytochrome P450 89A2-like, partial [Cucumis melo]) HSP 1 Score: 203.8 bits (517), Expect = 3.1e-49 Identity = 99/110 (90.00%), Postives = 102/110 (92.73%), Query Frame = 0
BLAST of MELO3C021845.2 vs. NCBI nr
Match: XP_004148097.1 (PREDICTED: cytochrome P450 89A2-like [Cucumis sativus] >KGN63390.1 hypothetical protein Csa_2G435530 [Cucumis sativus]) HSP 1 Score: 201.4 bits (511), Expect = 1.5e-48 Identity = 98/110 (89.09%), Postives = 101/110 (91.82%), Query Frame = 0
BLAST of MELO3C021845.2 vs. NCBI nr
Match: XP_008459160.1 (PREDICTED: cytochrome P450 89A2-like [Cucumis melo]) HSP 1 Score: 198.4 bits (503), Expect = 1.3e-47 Identity = 91/110 (82.73%), Postives = 101/110 (91.82%), Query Frame = 0
BLAST of MELO3C021845.2 vs. NCBI nr
Match: XP_004148096.2 (PREDICTED: cytochrome P450 89A2-like [Cucumis sativus] >KGN63389.1 hypothetical protein Csa_2G435520 [Cucumis sativus]) HSP 1 Score: 196.8 bits (499), Expect = 3.8e-47 Identity = 94/110 (85.45%), Postives = 100/110 (90.91%), Query Frame = 0
BLAST of MELO3C021845.2 vs. NCBI nr
Match: KGN63395.1 (hypothetical protein Csa_2G437050 [Cucumis sativus]) HSP 1 Score: 192.6 bits (488), Expect = 7.1e-46 Identity = 89/110 (80.91%), Postives = 99/110 (90.00%), Query Frame = 0
BLAST of MELO3C021845.2 vs. TAIR10
Match: AT3G03470.1 (cytochrome P450, family 87, subfamily A, polypeptide 9) HSP 1 Score: 159.5 bits (402), Expect = 1.2e-39 Identity = 72/111 (64.86%), Postives = 91/111 (81.98%), Query Frame = 0
BLAST of MELO3C021845.2 vs. TAIR10
Match: AT1G64930.1 (cytochrome P450, family 87, subfamily A, polypeptide 7) HSP 1 Score: 153.3 bits (386), Expect = 8.7e-38 Identity = 72/110 (65.45%), Postives = 90/110 (81.82%), Query Frame = 0
BLAST of MELO3C021845.2 vs. TAIR10
Match: AT1G64950.1 (cytochrome P450, family 89, subfamily A, polypeptide 5) HSP 1 Score: 152.5 bits (384), Expect = 1.5e-37 Identity = 71/110 (64.55%), Postives = 87/110 (79.09%), Query Frame = 0
BLAST of MELO3C021845.2 vs. TAIR10
Match: AT1G64940.1 (cytochrome P450, family 87, subfamily A, polypeptide 6) HSP 1 Score: 152.1 bits (383), Expect = 1.9e-37 Identity = 71/110 (64.55%), Postives = 87/110 (79.09%), Query Frame = 0
BLAST of MELO3C021845.2 vs. TAIR10
Match: AT1G64900.1 (cytochrome P450, family 89, subfamily A, polypeptide 2) HSP 1 Score: 148.7 bits (374), Expect = 2.1e-36 Identity = 71/110 (64.55%), Postives = 88/110 (80.00%), Query Frame = 0
BLAST of MELO3C021845.2 vs. Swiss-Prot
Match: sp|Q9SRQ1|C89A9_ARATH (Cytochrome P450 89A9 OS=Arabidopsis thaliana OX=3702 GN=CYP89A9 PE=2 SV=1) HSP 1 Score: 159.5 bits (402), Expect = 2.2e-38 Identity = 72/111 (64.86%), Postives = 91/111 (81.98%), Query Frame = 0
BLAST of MELO3C021845.2 vs. Swiss-Prot
Match: sp|Q42602|C89A2_ARATH (Cytochrome P450 89A2 OS=Arabidopsis thaliana OX=3702 GN=CYP89A2 PE=2 SV=2) HSP 1 Score: 148.7 bits (374), Expect = 3.9e-35 Identity = 71/110 (64.55%), Postives = 88/110 (80.00%), Query Frame = 0
BLAST of MELO3C021845.2 vs. Swiss-Prot
Match: sp|P37123|C77A1_SOLME (Cytochrome P450 77A1 (Fragment) OS=Solanum melongena OX=4111 GN=CYP77A1 PE=2 SV=1) HSP 1 Score: 112.1 bits (279), Expect = 4.0e-24 Identity = 53/104 (50.96%), Postives = 68/104 (65.38%), Query Frame = 0
BLAST of MELO3C021845.2 vs. Swiss-Prot
Match: sp|P37124|C77A2_SOLME (Cytochrome P450 77A2 OS=Solanum melongena OX=4111 GN=CYP77A2 PE=2 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 3.2e-21 Identity = 50/106 (47.17%), Postives = 66/106 (62.26%), Query Frame = 0
BLAST of MELO3C021845.2 vs. Swiss-Prot
Match: sp|Q9LZ31|C77A4_ARATH (Cytochrome P450 77A4 OS=Arabidopsis thaliana OX=3702 GN=CYP77A4 PE=2 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 3.2e-21 Identity = 48/107 (44.86%), Postives = 68/107 (63.55%), Query Frame = 0
BLAST of MELO3C021845.2 vs. TrEMBL
Match: tr|A0A1S3C9W5|A0A1S3C9W5_CUCME (cytochrome P450 89A2-like OS=Cucumis melo OX=3656 GN=LOC103498444 PE=3 SV=1) HSP 1 Score: 203.8 bits (517), Expect = 2.1e-49 Identity = 99/110 (90.00%), Postives = 102/110 (92.73%), Query Frame = 0
BLAST of MELO3C021845.2 vs. TrEMBL
Match: tr|A0A0A0LNB1|A0A0A0LNB1_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G435530 PE=3 SV=1) HSP 1 Score: 201.4 bits (511), Expect = 1.0e-48 Identity = 98/110 (89.09%), Postives = 101/110 (91.82%), Query Frame = 0
BLAST of MELO3C021845.2 vs. TrEMBL
Match: tr|A0A1S3CAR2|A0A1S3CAR2_CUCME (cytochrome P450 89A2-like OS=Cucumis melo OX=3656 GN=LOC103498359 PE=3 SV=1) HSP 1 Score: 198.4 bits (503), Expect = 8.6e-48 Identity = 91/110 (82.73%), Postives = 101/110 (91.82%), Query Frame = 0
BLAST of MELO3C021845.2 vs. TrEMBL
Match: tr|A0A0A0LQX4|A0A0A0LQX4_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G435520 PE=3 SV=1) HSP 1 Score: 196.8 bits (499), Expect = 2.5e-47 Identity = 94/110 (85.45%), Postives = 100/110 (90.91%), Query Frame = 0
BLAST of MELO3C021845.2 vs. TrEMBL
Match: tr|A0A0A0LNB6|A0A0A0LNB6_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G437050 PE=3 SV=1) HSP 1 Score: 192.6 bits (488), Expect = 4.7e-46 Identity = 89/110 (80.91%), Postives = 99/110 (90.00%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|