MELO3C021845 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGGCGGAGATGAGTCGAGATCCAAAAGTTTGGGAAGATCCGATGGAGTTTAAGCCGGAGAGGTTCTTGAAAGGCGGCGCCGGAAAAGAATGTGGAGTTGTGTTTGATATAACAGGGAGTAAAGAGATAAAGATGATGCCATTCGGAGCAGGGAGAAGAATGTGTCCTGGATTTGGTCTGGCAATTGTTCATTTGGAGTATTTCATTGCAAATTTGGTATGGAGGTTCGAATGGAAGGAAGTAAAGGGAGATGAAGTTAGTTTGGAAGAGAAAATAGAGTTCACAGTGGTGATGGAAAAGCCTTTGAAAGCGAACATAATTCCCAGGTGA ATGGTGGCGGAGATGAGTCGAGATCCAAAAGTTTGGGAAGATCCGATGGAGTTTAAGCCGGAGAGGTTCTTGAAAGGCGGCGCCGGAAAAGAATGTGGAGTTGTGTTTGATATAACAGGGAGTAAAGAGATAAAGATGATGCCATTCGGAGCAGGGAGAAGAATGTGTCCTGGATTTGGTCTGGCAATTGTTCATTTGGAGTATTTCATTGCAAATTTGGTATGGAGGTTCGAATGGAAGGAAGTAAAGGGAGATGAAGTTAGTTTGGAAGAGAAAATAGAGTTCACAGTGGTGATGGAAAAGCCTTTGAAAGCGAACATAATTCCCAGGTGA ATGGTGGCGGAGATGAGTCGAGATCCAAAAGTTTGGGAAGATCCGATGGAGTTTAAGCCGGAGAGGTTCTTGAAAGGCGGCGCCGGAAAAGAATGTGGAGTTGTGTTTGATATAACAGGGAGTAAAGAGATAAAGATGATGCCATTCGGAGCAGGGAGAAGAATGTGTCCTGGATTTGGTCTGGCAATTGTTCATTTGGAGTATTTCATTGCAAATTTGGTATGGAGGTTCGAATGGAAGGAAGTAAAGGGAGATGAAGTTAGTTTGGAAGAGAAAATAGAGTTCACAGTGGTGATGGAAAAGCCTTTGAAAGCGAACATAATTCCCAGGTGA MVAEMSRDPKVWEDPMEFKPERFLKGGAGKECGVVFDITGSKEIKMMPFGAGRRMCPGFGLAIVHLEYFIANLVWRFEWKEVKGDEVSLEEKIEFTVVMEKPLKANIIPR*
BLAST of MELO3C021845 vs. Swiss-Prot
Match: C89A9_ARATH (Cytochrome P450 89A9 OS=Arabidopsis thaliana GN=CYP89A9 PE=2 SV=1) HSP 1 Score: 157.5 bits (397), Expect = 8.3e-38 Identity = 72/111 (64.86%), Postives = 89/111 (80.18%), Query Frame = 1
BLAST of MELO3C021845 vs. Swiss-Prot
Match: C89A2_ARATH (Cytochrome P450 89A2 OS=Arabidopsis thaliana GN=CYP89A2 PE=2 SV=2) HSP 1 Score: 146.4 bits (368), Expect = 1.9e-34 Identity = 71/110 (64.55%), Postives = 86/110 (78.18%), Query Frame = 1
BLAST of MELO3C021845 vs. Swiss-Prot
Match: C77A1_SOLME (Cytochrome P450 77A1 (Fragment) OS=Solanum melongena GN=CYP77A1 PE=2 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 1.5e-23 Identity = 53/104 (50.96%), Postives = 66/104 (63.46%), Query Frame = 1
BLAST of MELO3C021845 vs. Swiss-Prot
Match: C77A2_SOLME (Cytochrome P450 77A2 OS=Solanum melongena GN=CYP77A2 PE=2 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 1.2e-20 Identity = 50/106 (47.17%), Postives = 64/106 (60.38%), Query Frame = 1
BLAST of MELO3C021845 vs. Swiss-Prot
Match: C77A4_ARATH (Cytochrome P450 77A4 OS=Arabidopsis thaliana GN=CYP77A4 PE=2 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 1.2e-20 Identity = 48/107 (44.86%), Postives = 66/107 (61.68%), Query Frame = 1
BLAST of MELO3C021845 vs. TrEMBL
Match: A0A0A0LNB1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G435530 PE=3 SV=1) HSP 1 Score: 199.1 bits (505), Expect = 2.8e-48 Identity = 98/110 (89.09%), Postives = 101/110 (91.82%), Query Frame = 1
BLAST of MELO3C021845 vs. TrEMBL
Match: A0A0A0LQX4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G435520 PE=3 SV=1) HSP 1 Score: 194.5 bits (493), Expect = 6.8e-47 Identity = 94/110 (85.45%), Postives = 100/110 (90.91%), Query Frame = 1
BLAST of MELO3C021845 vs. TrEMBL
Match: A0A0A0LNB6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G437050 PE=3 SV=1) HSP 1 Score: 190.3 bits (482), Expect = 1.3e-45 Identity = 89/110 (80.91%), Postives = 99/110 (90.00%), Query Frame = 1
BLAST of MELO3C021845 vs. TrEMBL
Match: A0A0A0LTQ9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G435540 PE=3 SV=1) HSP 1 Score: 188.0 bits (476), Expect = 6.4e-45 Identity = 88/110 (80.00%), Postives = 97/110 (88.18%), Query Frame = 1
BLAST of MELO3C021845 vs. TrEMBL
Match: A0A0A0LRF5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G436040 PE=3 SV=1) HSP 1 Score: 182.6 bits (462), Expect = 2.7e-43 Identity = 87/110 (79.09%), Postives = 95/110 (86.36%), Query Frame = 1
BLAST of MELO3C021845 vs. TAIR10
Match: AT3G03470.1 (AT3G03470.1 cytochrome P450, family 87, subfamily A, polypeptide 9) HSP 1 Score: 157.5 bits (397), Expect = 4.7e-39 Identity = 72/111 (64.86%), Postives = 89/111 (80.18%), Query Frame = 1
BLAST of MELO3C021845 vs. TAIR10
Match: AT1G64930.1 (AT1G64930.1 cytochrome P450, family 87, subfamily A, polypeptide 7) HSP 1 Score: 151.0 bits (380), Expect = 4.4e-37 Identity = 72/110 (65.45%), Postives = 88/110 (80.00%), Query Frame = 1
BLAST of MELO3C021845 vs. TAIR10
Match: AT1G64950.1 (AT1G64950.1 cytochrome P450, family 89, subfamily A, polypeptide 5) HSP 1 Score: 150.6 bits (379), Expect = 5.7e-37 Identity = 71/110 (64.55%), Postives = 85/110 (77.27%), Query Frame = 1
BLAST of MELO3C021845 vs. TAIR10
Match: AT1G64940.1 (AT1G64940.1 cytochrome P450, family 87, subfamily A, polypeptide 6) HSP 1 Score: 150.2 bits (378), Expect = 7.4e-37 Identity = 71/110 (64.55%), Postives = 85/110 (77.27%), Query Frame = 1
BLAST of MELO3C021845 vs. TAIR10
Match: AT1G64900.1 (AT1G64900.1 cytochrome P450, family 89, subfamily A, polypeptide 2) HSP 1 Score: 146.4 bits (368), Expect = 1.1e-35 Identity = 71/110 (64.55%), Postives = 86/110 (78.18%), Query Frame = 1
BLAST of MELO3C021845 vs. NCBI nr
Match: gi|659118724|ref|XP_008459270.1| (PREDICTED: cytochrome P450 89A2-like, partial [Cucumis melo]) HSP 1 Score: 201.4 bits (511), Expect = 8.0e-49 Identity = 99/110 (90.00%), Postives = 102/110 (92.73%), Query Frame = 1
BLAST of MELO3C021845 vs. NCBI nr
Match: gi|449460728|ref|XP_004148097.1| (PREDICTED: cytochrome P450 89A2-like [Cucumis sativus]) HSP 1 Score: 199.1 bits (505), Expect = 4.0e-48 Identity = 98/110 (89.09%), Postives = 101/110 (91.82%), Query Frame = 1
BLAST of MELO3C021845 vs. NCBI nr
Match: gi|659118513|ref|XP_008459160.1| (PREDICTED: cytochrome P450 89A2-like [Cucumis melo]) HSP 1 Score: 196.1 bits (497), Expect = 3.4e-47 Identity = 91/110 (82.73%), Postives = 101/110 (91.82%), Query Frame = 1
BLAST of MELO3C021845 vs. NCBI nr
Match: gi|778673842|ref|XP_004148096.2| (PREDICTED: cytochrome P450 89A2-like [Cucumis sativus]) HSP 1 Score: 194.5 bits (493), Expect = 9.8e-47 Identity = 94/110 (85.45%), Postives = 100/110 (90.91%), Query Frame = 1
BLAST of MELO3C021845 vs. NCBI nr
Match: gi|659118506|ref|XP_008459157.1| (PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 89A2-like [Cucumis melo]) HSP 1 Score: 192.2 bits (487), Expect = 4.8e-46 Identity = 93/110 (84.55%), Postives = 98/110 (89.09%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|