MELO3C021761 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCACAAGTGGAGGAGAAAGGCTCGAAAAATGGAAGAGATGATTATACGGAAGATGCAACTGTGAGTTTCAAAGGATTACCTGTCTTAAGATCAAAGACTGGGAGATGGAGAGCCTGTTCCTTCATTGTTGGTGATTATAAGTTTAGAGACTTGAAAACTGTAAAGAAAACCGTAGAAAATTGTAAGTAA ATGGCACAAGTGGAGGAGAAAGGCTCGAAAAATGGAAGAGATGATTATACGGAAGATGCAACTGTGAGTTTCAAAGGATTACCTGTCTTAAGATCAAAGACTGGGAGATGGAGAGCCTGTTCCTTCATTGTTGGTGATTATAAGTTTAGAGACTTGAAAACTGTAAAGAAAACCGTAGAAAATTGTAAGTAA ATGGCACAAGTGGAGGAGAAAGGCTCGAAAAATGGAAGAGATGATTATACGGAAGATGCAACTGTGAGTTTCAAAGGATTACCTGTCTTAAGATCAAAGACTGGGAGATGGAGAGCCTGTTCCTTCATTGTTGGTGATTATAAGTTTAGAGACTTGAAAACTGTAAAGAAAACCGTAGAAAATTGTAAGTAA MAQVEEKGSKNGRDDYTEDATVSFKGLPVLRSKTGRWRACSFIVGDYKFRDLKTVKKTVENCK*
BLAST of MELO3C021761 vs. Swiss-Prot
Match: PTR30_ARATH (Protein NRT1/ PTR FAMILY 5.1 OS=Arabidopsis thaliana GN=NPF5.1 PE=2 SV=2) HSP 1 Score: 51.2 bits (121), Expect = 4.8e-06 Identity = 21/30 (70.00%), Postives = 23/30 (76.67%), Query Frame = 1
BLAST of MELO3C021761 vs. TrEMBL
Match: A0A0A0LC54_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G608170 PE=4 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 3.4e-14 Identity = 40/44 (90.91%), Postives = 41/44 (93.18%), Query Frame = 1
BLAST of MELO3C021761 vs. TrEMBL
Match: A0A061DPK9_THECC (Peptide transporter PTR3-A OS=Theobroma cacao GN=TCM_003950 PE=4 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 7.0e-12 Identity = 35/45 (77.78%), Postives = 40/45 (88.89%), Query Frame = 1
BLAST of MELO3C021761 vs. TrEMBL
Match: B9SKP9_RICCO (Oligopeptide transporter, putative OS=Ricinus communis GN=RCOM_0543240 PE=4 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 1.2e-11 Identity = 35/45 (77.78%), Postives = 37/45 (82.22%), Query Frame = 1
BLAST of MELO3C021761 vs. TrEMBL
Match: M5VUR8_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa026888mg PE=4 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 1.2e-11 Identity = 34/45 (75.56%), Postives = 39/45 (86.67%), Query Frame = 1
BLAST of MELO3C021761 vs. TrEMBL
Match: A0A067K3U8_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_17647 PE=4 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 1.6e-11 Identity = 33/45 (73.33%), Postives = 37/45 (82.22%), Query Frame = 1
BLAST of MELO3C021761 vs. TAIR10
Match: AT2G40460.1 (AT2G40460.1 Major facilitator superfamily protein) HSP 1 Score: 51.2 bits (121), Expect = 2.7e-07 Identity = 21/30 (70.00%), Postives = 23/30 (76.67%), Query Frame = 1
BLAST of MELO3C021761 vs. TAIR10
Match: AT5G46040.1 (AT5G46040.1 Major facilitator superfamily protein) HSP 1 Score: 49.3 bits (116), Expect = 1.0e-06 Identity = 24/41 (58.54%), Postives = 27/41 (65.85%), Query Frame = 1
BLAST of MELO3C021761 vs. TAIR10
Match: AT5G46050.1 (AT5G46050.1 peptide transporter 3) HSP 1 Score: 48.5 bits (114), Expect = 1.8e-06 Identity = 24/41 (58.54%), Postives = 26/41 (63.41%), Query Frame = 1
BLAST of MELO3C021761 vs. NCBI nr
Match: gi|659093138|ref|XP_008447390.1| (PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 5.2-like [Cucumis melo]) HSP 1 Score: 85.1 bits (209), Expect = 4.8e-14 Identity = 40/44 (90.91%), Postives = 41/44 (93.18%), Query Frame = 1
BLAST of MELO3C021761 vs. NCBI nr
Match: gi|449468700|ref|XP_004152059.1| (PREDICTED: protein NRT1/ PTR FAMILY 5.2-like [Cucumis sativus]) HSP 1 Score: 85.1 bits (209), Expect = 4.8e-14 Identity = 40/44 (90.91%), Postives = 41/44 (93.18%), Query Frame = 1
BLAST of MELO3C021761 vs. NCBI nr
Match: gi|590715454|ref|XP_007050200.1| (Peptide transporter PTR3-A [Theobroma cacao]) HSP 1 Score: 77.4 bits (189), Expect = 1.0e-11 Identity = 35/45 (77.78%), Postives = 40/45 (88.89%), Query Frame = 1
BLAST of MELO3C021761 vs. NCBI nr
Match: gi|645259976|ref|XP_008235618.1| (PREDICTED: protein NRT1/ PTR FAMILY 5.2-like [Prunus mume]) HSP 1 Score: 76.6 bits (187), Expect = 1.7e-11 Identity = 34/45 (75.56%), Postives = 39/45 (86.67%), Query Frame = 1
BLAST of MELO3C021761 vs. NCBI nr
Match: gi|595791411|ref|XP_007199454.1| (hypothetical protein PRUPE_ppa026888mg [Prunus persica]) HSP 1 Score: 76.6 bits (187), Expect = 1.7e-11 Identity = 34/45 (75.56%), Postives = 39/45 (86.67%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|