MELO3C021574 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTATTTGTTGTAGGGTCCATATTTTTGTTCACAATAGGAGAACTCATTAGAATAGTCCCGACAAATTCAGGGCTAAGCATTGCTCTACATGATACCTATTTTGTGGTTGCACATTTCCATTATGTACTTTCTATAGGAGTCGTGATGATTTTTTGCTTTAATTGCAGGATTTCACTATTGGGTGGGTAAATCTTTTGTCCGATATACCCTGAAACTTTAGGTCAAATCCATTTTTGGATCACTTTTTTCAGGGTTAATCCGACCCTCTTTCCCATGCACTTCTTAGGTCTTTTGGGTATGCCACGTCGCATTCCTGATTATCTAGATGCTTACGCTGATGATGGATGA ATGTTATTTGTTGTAGGGTCCATATTTTTGTTCACAATAGGAGAACTCATTAGAATAGTCCCGACAAATTCAGGGCTAAGCATTGCTCTACATGATACCTATTTTGTGGTTGCACATTTCCATTATGTACTTTCTATAGGAGTCGTGATGATTTTTTGCTTTAATTGCAGGATTTCACTATTGGGTCAAATCCATTTTTGGATCACTTTTTTCAGGGTTAATCCGACCCTCTTTCCCATGCACTTCTTAGGTCTTTTGGGTATGCCACGTCGCATTCCTGATTATCTAGATGCTTACGCTGATGATGGATGA ATGTTATTTGTTGTAGGGTCCATATTTTTGTTCACAATAGGAGAACTCATTAGAATAGTCCCGACAAATTCAGGGCTAAGCATTGCTCTACATGATACCTATTTTGTGGTTGCACATTTCCATTATGTACTTTCTATAGGAGTCGTGATGATTTTTTGCTTTAATTGCAGGATTTCACTATTGGGTCAAATCCATTTTTGGATCACTTTTTTCAGGGTTAATCCGACCCTCTTTCCCATGCACTTCTTAGGTCTTTTGGGTATGCCACGTCGCATTCCTGATTATCTAGATGCTTACGCTGATGATGGATGA MLFVVGSIFLFTIGELIRIVPTNSGLSIALHDTYFVVAHFHYVLSIGVVMIFCFNCRISLLGQIHFWITFFRVNPTLFPMHFLGLLGMPRRIPDYLDAYADDG*
BLAST of MELO3C021574 vs. Swiss-Prot
Match: COX1_PEA (Cytochrome c oxidase subunit 1 OS=Pisum sativum GN=COX1 PE=3 SV=2) HSP 1 Score: 141.4 bits (355), Expect = 5.8e-33 Identity = 74/111 (66.67%), Postives = 75/111 (67.57%), Query Frame = 1
BLAST of MELO3C021574 vs. Swiss-Prot
Match: COX1_OENBE (Cytochrome c oxidase subunit 1 OS=Oenothera berteroana GN=COX1 PE=3 SV=2) HSP 1 Score: 139.4 bits (350), Expect = 2.2e-32 Identity = 71/111 (63.96%), Postives = 74/111 (66.67%), Query Frame = 1
BLAST of MELO3C021574 vs. Swiss-Prot
Match: COX1_SOYBN (Cytochrome c oxidase subunit 1 OS=Glycine max GN=COX1 PE=3 SV=3) HSP 1 Score: 139.0 bits (349), Expect = 2.9e-32 Identity = 74/111 (66.67%), Postives = 74/111 (66.67%), Query Frame = 1
BLAST of MELO3C021574 vs. Swiss-Prot
Match: COX1_ORYSJ (Cytochrome c oxidase subunit 1 OS=Oryza sativa subsp. japonica GN=COX1 PE=3 SV=2) HSP 1 Score: 137.1 bits (344), Expect = 1.1e-31 Identity = 74/111 (66.67%), Postives = 77/111 (69.37%), Query Frame = 1
BLAST of MELO3C021574 vs. Swiss-Prot
Match: COX1_MAIZE (Cytochrome c oxidase subunit 1 OS=Zea mays GN=COX1 PE=3 SV=2) HSP 1 Score: 137.1 bits (344), Expect = 1.1e-31 Identity = 74/111 (66.67%), Postives = 77/111 (69.37%), Query Frame = 1
BLAST of MELO3C021574 vs. TrEMBL
Match: G3EIX2_CUCSA (Cytochrome c oxidase subunit 1 OS=Cucumis sativus GN=cox1 PE=3 SV=1) HSP 1 Score: 149.1 bits (375), Expect = 3.1e-33 Identity = 77/111 (69.37%), Postives = 79/111 (71.17%), Query Frame = 1
BLAST of MELO3C021574 vs. TrEMBL
Match: B4XPH1_CUCME (Cytochrome c oxidase subunit 1 (Fragment) OS=Cucumis melo GN=cox1 PE=3 SV=1) HSP 1 Score: 149.1 bits (375), Expect = 3.1e-33 Identity = 77/111 (69.37%), Postives = 79/111 (71.17%), Query Frame = 1
BLAST of MELO3C021574 vs. TrEMBL
Match: B4XPH5_9ROSI (Cytochrome c oxidase subunit 1 (Fragment) OS=Neoachmandra indica GN=cox1 PE=3 SV=1) HSP 1 Score: 149.1 bits (375), Expect = 3.1e-33 Identity = 77/111 (69.37%), Postives = 79/111 (71.17%), Query Frame = 1
BLAST of MELO3C021574 vs. TrEMBL
Match: G3EU24_CUCME (Cytochrome c oxidase subunit 1 OS=Cucumis melo subsp. melo GN=cox1 PE=3 SV=1) HSP 1 Score: 149.1 bits (375), Expect = 3.1e-33 Identity = 77/111 (69.37%), Postives = 79/111 (71.17%), Query Frame = 1
BLAST of MELO3C021574 vs. TrEMBL
Match: B4XPH3_9ROSI (Cytochrome c oxidase subunit 1 (Fragment) OS=Cucumis metulifer GN=cox1 PE=3 SV=1) HSP 1 Score: 149.1 bits (375), Expect = 3.1e-33 Identity = 77/111 (69.37%), Postives = 79/111 (71.17%), Query Frame = 1
BLAST of MELO3C021574 vs. TAIR10
Match: ATMG01360.1 (ATMG01360.1 cytochrome oxidase) HSP 1 Score: 137.1 bits (344), Expect = 6.1e-33 Identity = 74/111 (66.67%), Postives = 77/111 (69.37%), Query Frame = 1
BLAST of MELO3C021574 vs. NCBI nr
Match: gi|166165030|gb|ABY83868.1| (cytochrome oxidase subunit 1, partial (mitochondrion) [Citrullus lanatus subsp. vulgaris]) HSP 1 Score: 149.1 bits (375), Expect = 4.4e-33 Identity = 77/111 (69.37%), Postives = 79/111 (71.17%), Query Frame = 1
BLAST of MELO3C021574 vs. NCBI nr
Match: gi|164685362|gb|ABY66627.1| (cytochrome oxidase subunit I, partial (mitochondrion) [Echinocystis lobata]) HSP 1 Score: 149.1 bits (375), Expect = 4.4e-33 Identity = 77/111 (69.37%), Postives = 79/111 (71.17%), Query Frame = 1
BLAST of MELO3C021574 vs. NCBI nr
Match: gi|346683358|ref|YP_004849320.1| (cytochrome c oxidase subunit 1 [Cucumis sativus]) HSP 1 Score: 149.1 bits (375), Expect = 4.4e-33 Identity = 77/111 (69.37%), Postives = 79/111 (71.17%), Query Frame = 1
BLAST of MELO3C021574 vs. NCBI nr
Match: gi|166165033|gb|ABY83870.1| (cytochrome oxidase subunit 1, partial (mitochondrion) [Cucumis melo]) HSP 1 Score: 149.1 bits (375), Expect = 4.4e-33 Identity = 77/111 (69.37%), Postives = 79/111 (71.17%), Query Frame = 1
BLAST of MELO3C021574 vs. NCBI nr
Match: gi|3288134|emb|CAA11318.1| (cytochrome c oxidase subunit I [Cucumis sativus]) HSP 1 Score: 149.1 bits (375), Expect = 4.4e-33 Identity = 77/111 (69.37%), Postives = 79/111 (71.17%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |