MELO3C021498 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCATTTGAGATATGGTATGGACGCAGTCGATTTAATTTCACAGAAGTCAATGAGAACAAAGGAGGAAATATAAGAACAAGCTTCGAGAGAGGAGTTCATGGCGATTATCATCCTTTAACTAATGATACAAAAACTTTGGCACATACTTTTGCACCAACAGATGGGAGATTTCACTTTAATGCTGATAAACCTTTTTCAGTTGAAGCTACATATGGTGCGTATCATTTGAAGACTATGGCATTGCATGAGCTTGGACATGCATTTGGGTTGGCTCATAGCCCAAGTGAAGATTCCATTGTGTTTCCCACTGTACCTACTAATCTTGAAAAGGATTTAGATACAGATGATATTAAAGGATTGTGGGAGTTATATGATGGATTTGGTGTTGCTTAA ATGGCATTTGAGATATGGTATGGACGCAGTCGATTTAATTTCACAGAAGTCAATGAGAACAAAGGAGGAAATATAAGAACAAGCTTCGAGAGAGGAGTTCATGGCGATTATCATCCTTTAACTAATGATACAAAAACTTTGGCACATACTTTTGCACCAACAGATGGGAGATTTCACTTTAATGCTGATAAACCTTTTTCAGTTGAAGCTACATATGGTGCGTATCATTTGAAGACTATGGCATTGCATGAGCTTGGACATGCATTTGGGTTGGCTCATAGCCCAAGTGAAGATTCCATTGTGTTTCCCACTGTACCTACTAATCTTGAAAAGGATTTAGATACAGATGATATTAAAGGATTGTGGGAGTTATATGATGGATTTGGTGTTGCTTAA ATGGCATTTGAGATATGGTATGGACGCAGTCGATTTAATTTCACAGAAGTCAATGAGAACAAAGGAGGAAATATAAGAACAAGCTTCGAGAGAGGAGTTCATGGCGATTATCATCCTTTAACTAATGATACAAAAACTTTGGCACATACTTTTGCACCAACAGATGGGAGATTTCACTTTAATGCTGATAAACCTTTTTCAGTTGAAGCTACATATGGTGCGTATCATTTGAAGACTATGGCATTGCATGAGCTTGGACATGCATTTGGGTTGGCTCATAGCCCAAGTGAAGATTCCATTGTGTTTCCCACTGTACCTACTAATCTTGAAAAGGATTTAGATACAGATGATATTAAAGGATTGTGGGAGTTATATGATGGATTTGGTGTTGCTTAA MAFEIWYGRSRFNFTEVNENKGGNIRTSFERGVHGDYHPLTNDTKTLAHTFAPTDGRFHFNADKPFSVEATYGAYHLKTMALHELGHAFGLAHSPSEDSIVFPTVPTNLEKDLDTDDIKGLWELYDGFGVA*
BLAST of MELO3C021498 vs. Swiss-Prot
Match: 2MMP_ARATH (Metalloendoproteinase 2-MMP OS=Arabidopsis thaliana GN=2MMP PE=1 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.5e-17 Identity = 50/132 (37.88%), Postives = 69/132 (52.27%), Query Frame = 1
BLAST of MELO3C021498 vs. Swiss-Prot
Match: 3MMP_ARATH (Metalloendoproteinase 3-MMP OS=Arabidopsis thaliana GN=3MMP PE=1 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.5e-17 Identity = 50/133 (37.59%), Postives = 67/133 (50.38%), Query Frame = 1
BLAST of MELO3C021498 vs. Swiss-Prot
Match: MEP1_SOYBN (Metalloendoproteinase 1 OS=Glycine max PE=1 SV=2) HSP 1 Score: 84.3 bits (207), Expect = 1.1e-15 Identity = 47/131 (35.88%), Postives = 65/131 (49.62%), Query Frame = 1
BLAST of MELO3C021498 vs. Swiss-Prot
Match: 1MMP_ARATH (Metalloendoproteinase 1-MMP OS=Arabidopsis thaliana GN=1MMP PE=1 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 2.4e-15 Identity = 45/130 (34.62%), Postives = 70/130 (53.85%), Query Frame = 1
BLAST of MELO3C021498 vs. Swiss-Prot
Match: 4MMP_ARATH (Metalloendoproteinase 4-MMP OS=Arabidopsis thaliana GN=4MMP PE=1 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 2.6e-14 Identity = 44/129 (34.11%), Postives = 69/129 (53.49%), Query Frame = 1
BLAST of MELO3C021498 vs. TrEMBL
Match: A0A0A0KS15_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G632090 PE=3 SV=1) HSP 1 Score: 249.2 bits (635), Expect = 2.8e-63 Identity = 112/130 (86.15%), Postives = 123/130 (94.62%), Query Frame = 1
BLAST of MELO3C021498 vs. TrEMBL
Match: A0A0A0KX75_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G632100 PE=3 SV=1) HSP 1 Score: 152.1 bits (383), Expect = 4.6e-34 Identity = 70/129 (54.26%), Postives = 89/129 (68.99%), Query Frame = 1
BLAST of MELO3C021498 vs. TrEMBL
Match: M5X9G2_PRUPE (Uncharacterized protein (Fragment) OS=Prunus persica GN=PRUPE_ppa016355mg PE=3 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 6.7e-25 Identity = 55/124 (44.35%), Postives = 79/124 (63.71%), Query Frame = 1
BLAST of MELO3C021498 vs. TrEMBL
Match: A0A0D2PWZ0_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_001G258900 PE=3 SV=1) HSP 1 Score: 121.3 bits (303), Expect = 8.7e-25 Identity = 58/125 (46.40%), Postives = 77/125 (61.60%), Query Frame = 1
BLAST of MELO3C021498 vs. TrEMBL
Match: B9RUG6_RICCO (Metalloendoproteinase 1, putative OS=Ricinus communis GN=RCOM_0852690 PE=3 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 1.9e-24 Identity = 55/125 (44.00%), Postives = 79/125 (63.20%), Query Frame = 1
BLAST of MELO3C021498 vs. TAIR10
Match: AT1G70170.1 (AT1G70170.1 matrix metalloproteinase) HSP 1 Score: 90.5 bits (223), Expect = 8.3e-19 Identity = 50/132 (37.88%), Postives = 69/132 (52.27%), Query Frame = 1
BLAST of MELO3C021498 vs. TAIR10
Match: AT1G24140.1 (AT1G24140.1 Matrixin family protein) HSP 1 Score: 90.5 bits (223), Expect = 8.3e-19 Identity = 50/133 (37.59%), Postives = 67/133 (50.38%), Query Frame = 1
BLAST of MELO3C021498 vs. TAIR10
Match: AT4G16640.1 (AT4G16640.1 Matrixin family protein) HSP 1 Score: 83.2 bits (204), Expect = 1.3e-16 Identity = 45/130 (34.62%), Postives = 70/130 (53.85%), Query Frame = 1
BLAST of MELO3C021498 vs. TAIR10
Match: AT2G45040.1 (AT2G45040.1 Matrixin family protein) HSP 1 Score: 79.7 bits (195), Expect = 1.5e-15 Identity = 44/129 (34.11%), Postives = 69/129 (53.49%), Query Frame = 1
BLAST of MELO3C021498 vs. TAIR10
Match: AT1G59970.1 (AT1G59970.1 Matrixin family protein) HSP 1 Score: 74.7 bits (182), Expect = 4.7e-14 Identity = 45/136 (33.09%), Postives = 61/136 (44.85%), Query Frame = 1
BLAST of MELO3C021498 vs. NCBI nr
Match: gi|449449423|ref|XP_004142464.1| (PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]) HSP 1 Score: 249.2 bits (635), Expect = 4.0e-63 Identity = 112/130 (86.15%), Postives = 123/130 (94.62%), Query Frame = 1
BLAST of MELO3C021498 vs. NCBI nr
Match: gi|700197234|gb|KGN52411.1| (hypothetical protein Csa_5G632100 [Cucumis sativus]) HSP 1 Score: 152.1 bits (383), Expect = 6.6e-34 Identity = 70/129 (54.26%), Postives = 89/129 (68.99%), Query Frame = 1
BLAST of MELO3C021498 vs. NCBI nr
Match: gi|778708743|ref|XP_011656274.1| (PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]) HSP 1 Score: 152.1 bits (383), Expect = 6.6e-34 Identity = 70/129 (54.26%), Postives = 89/129 (68.99%), Query Frame = 1
BLAST of MELO3C021498 vs. NCBI nr
Match: gi|659118021|ref|XP_008458908.1| (PREDICTED: metalloendoproteinase 1-like [Cucumis melo]) HSP 1 Score: 136.3 bits (342), Expect = 3.8e-29 Identity = 64/124 (51.61%), Postives = 82/124 (66.13%), Query Frame = 1
BLAST of MELO3C021498 vs. NCBI nr
Match: gi|1009124722|ref|XP_015879223.1| (PREDICTED: metalloendoproteinase 3-MMP-like [Ziziphus jujuba]) HSP 1 Score: 127.5 bits (319), Expect = 1.7e-26 Identity = 61/125 (48.80%), Postives = 83/125 (66.40%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |